PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_10415-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 282aa    MW: 30990 Da    PI: 7.4996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_10415-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  TRIUR3_10415-P1 16 KGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 63
                     79********************************************97 PP

2Myb_DNA-binding475.9e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  TRIUR3_10415-P1  69 RGNFTQHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 114
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.9581167IPR017930Myb domain
SuperFamilySSF466892.7E-3013110IPR009057Homeodomain-like
SMARTSM007177.4E-141565IPR001005SANT/Myb domain
PfamPF002492.2E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231770IPR009057Homeodomain-like
CDDcd001671.25E-121863No hitNo description
PROSITE profilePS5129418.95368118IPR017930Myb domain
SMARTSM007173.3E-1368116IPR001005SANT/Myb domain
PfamPF002494.6E-1369114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2471118IPR009057Homeodomain-like
CDDcd001677.55E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRPPCCDNG GASVKKGPWT PEEDIILVSY IQQHGPGNWR SVPENTGLMR CSKSCRLRWT  60
NYLRPGIKRG NFTQHEEGII IHLQALLGNK WAAIASYLPQ RTDNDIKNYW NTHLKKKVKR  120
LQQQTHPADH FFQHTSTATN AAEQTTSMNY YNPSSSNLDS AMQAAMGYPE TTTGNVPPAT  180
MAVSKLFQSW MPKVPSPEMA DYKGMVAMQE FRTDGEAGAA VSMTSGNRFS SSEILAGRGE  240
AATATTFSVL ENWLLDDMAP GQAAMDGLMD ISAGCCANPI MF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1108441e-137AK110844.1 Oryza sativa Japonica Group cDNA clone:002-172-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577454.11e-151PREDICTED: transcription factor MYB30-like
TrEMBLT1LZ700.0T1LZ70_TRIUA; Uncharacterized protein
STRINGMLOC_17662.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.14e-80myb domain protein 30