PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_09734-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 242aa    MW: 25705 Da    PI: 8.9589
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_09734-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.6e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ede l+ ++k +G g+Wk ++ + g++R++k+c++rw++yl
  TRIUR3_09734-P1 13 RGAWTCKEDETLASYIKAHGEGRWKEVPLKAGLRRCGKSCRLRWLNYL 60
                     89********************************************97 PP

2Myb_DNA-binding51.52.3e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  TRIUR3_09734-P1  66 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSI 110
                      7899******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.058860IPR017930Myb domain
SuperFamilySSF466891.64E-2710107IPR009057Homeodomain-like
SMARTSM007175.9E-111262IPR001005SANT/Myb domain
PfamPF002493.5E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-221467IPR009057Homeodomain-like
CDDcd001674.29E-81560No hitNo description
PROSITE profilePS5129424.73261115IPR017930Myb domain
SMARTSM007175.0E-1565113IPR001005SANT/Myb domain
PfamPF002492.7E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2368114IPR009057Homeodomain-like
CDDcd001673.79E-1170111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MRRACSAKEG VKRGAWTCKE DETLASYIKA HGEGRWKEVP LKAGLRRCGK SCRLRWLNYL  60
RPSIKRGNIS DDEEELIVRL HRLLGNRWSL IAGRLPGRTD NEIKNYWNSI LGRKALPERA  120
ATRVVATPCA SASSGSSTGA STAGLSSNCG AGTSAKAAGL LSSASVWVPK PVRCTGGLFL  180
SGDAPLPAPV TQTRAVGGDG DECSGSSLAA SSGGGDWMDD VRALASFLES DEDWVNSLHM  240
AD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2521460.0AB252146.1 Triticum aestivum Tamyb3 mRNA for myb-related protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436658.18e-84hypothetical protein SORBIDRAFT_10g006700
SwissprotP102906e-78MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLM7ZR441e-174M7ZR44_TRIUA; Anthocyanin regulatory C1 protein
STRINGGRMZM2G701063_P012e-85(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-56myb domain protein 5