PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08699-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 613aa    MW: 68380.2 Da    PI: 5.9937
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08699-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.71.3e-802665712307
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cAeavss+d + a++lL+r++ ++sp+gd+ qRla+yf ++L+arla+++s+ly+al  ++t    ++  ++a++l   ++  +k++ 
  TRIUR3_08699-P1 266 ETLLIRCAEAVSSNDVHGASKLLERIKWHSSPTGDAKQRLAHYFSQGLEARLAGTGSRLYRALMEKHTL---TVGLIKAFHLHMAACCSMKVGL 356
                      789**********************************************************99988887...8999****************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      l a ++I +av+g +++Hi+ ++i+ G+QWp Ll+ La+R++gpp++RiTg++ p++g   ++ +ee g+rL + A+++gvpfef++ va++ e
  TRIUR3_08699-P1 357 LFAINTICKAVAGRRKLHIVHYGITTGFQWPDLLRLLANREGGPPQVRITGINTPRPGlrPAQIMEEAGDRLGNCAKQFGVPFEFRA-VASKPE 449
                      *********************************************************9*99**************************.7***** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      d++ e+L+++p+E+l+Vn++++  +l+des++ +   +rd vL+ + +++P v+v +  +  ++++ F++rf +al+y++alfd +e+++pr++
  TRIUR3_08699-P1 450 DVRAEDLHIDPDEVLVVNSMYEFRTLMDESLTFDMvsPRDMVLNNISKMRPAVFVQSLVNGPYSAAFFMTRFRHALYYFTALFDVMENTVPRDN 543
                      *****************************98765555********************************************************* PP

             GRAS 280 eerikvErellgreivnvvacegaerre 307
                      ++r  vEr +l+r++ n++ace  +r+ 
  TRIUR3_08699-P1 544 DQRLLVERDMLARSAINMIACEVPNRKD 571
                      **********************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.027239613IPR005202Transcription factor GRAS
PfamPF035144.5E-78266571IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MAATPEELLG LAEPAPLSPS VFLDLPPTPM THDDSQQPQN DLALEYISRM LTEEDIVDKF  60
FYQYPDHPEL LQAEQPFAEI LANTSSDAHE SFASSTSILM PSQGNGTDFM VSRCQVQYPA  120
FFLNGTGIAE ASGLVFPIPS ESSTRTDMLS SMAFFRGMEE ANRFLPADNV MVAGRGRKKR  180
PGMDGEVEAG LGRSSKQITV LPRCVQEEEE ATALEMLDRL VLNGYDAHPG EMQEVVRVTL  240
EDKENKSAIG RRGRRGARHT VVTDLETLLI RCAEAVSSND VHGASKLLER IKWHSSPTGD  300
AKQRLAHYFS QGLEARLAGT GSRLYRALME KHTLTVGLIK AFHLHMAACC SMKVGLLFAI  360
NTICKAVAGR RKLHIVHYGI TTGFQWPDLL RLLANREGGP PQVRITGINT PRPGLRPAQI  420
MEEAGDRLGN CAKQFGVPFE FRAVASKPED VRAEDLHIDP DEVLVVNSMY EFRTLMDESL  480
TFDMVSPRDM VLNNISKMRP AVFVQSLVNG PYSAAFFMTR FRHALYYFTA LFDVMENTVP  540
RDNDQRLLVE RDMLARSAIN MIACEVPNRK DILSRSSILV QNFGGQVTNE ISTRIMGKTI  600
RIYLHDAIYE DMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-322695548288GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750620.0AK375062.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3084L15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLM8A2X90.0M8A2X9_TRIUA; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-95GRAS family protein