PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08698-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 644aa    MW: 72084.1 Da    PI: 5.2764
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08698-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS317.43.1e-972706402373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lLl cA+ v++g+ + a +lL++++++as +gd+ qRla +f+++L+arla+++s++yk+l +++ts   + e l+ ++lf  ++ + ++++
  TRIUR3_08698-P1 270 RGLLLCCAQEVATGNRHGAGNLLKQIRQHASATGDAAQRLAYCFAKGLEARLAGTGSQVYKSLMAKHTS---TMEFLKGYELFMAACSFKRVAF 360
                      679*************************************************************99999...899******************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                           +I +aveg++++Hi+D+++ +G QWp Ll  La+R++gpp++RiTg++ p++g   +++leetg+ L++ A+++g+pf+f++ +a ++e
  TRIUR3_08698-P1 361 TFSSMTIFDAVEGKSKLHIVDYGLHYGCQWPGLLAWLATRDGGPPEVRITGIDLPQPGfrPAKRLEETGRALSNCARQFGLPFKFHA-IAAKWE 453
                      *********************************************************9*****************************.799*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      +++ e+L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+ +++++++v+v    + +  ++ Fl+rf eal +ys++fd+l+++ p+es
  TRIUR3_08698-P1 454 TIRAEDLNIDPDEVLVVNDLFNFNTLMDESLVIDRpsPRDVVLSNIREMQADVFVQGVVNGSS-GPFFLARFREALFFYSSVFDMLDTTTPPES 546
                      ******************************98877669****************999888776.89**************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er ++Er ++g+ + n +ace a+r+er et+++W+ r ++aG++++pl+  ++k a   ++  + +++ v+ ++g+l++gWk+r L++ SaW
  TRIUR3_08698-P1 547 YERFVLERDMFGQCALNTIACESADRVERPETYKQWQLRNQRAGLRQLPLKPIITKVATGKVKSLYHKEFVVDVDQGWLLQGWKGRILYAHSAW 640
                      ******************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.637243621IPR005202Transcription factor GRAS
PfamPF035141.1E-94270640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MPIAPEELLG LKEHMEPPPP SPSVYLDIPP SPYGGSVGDL VLPYITRMLM EEDIDDRFFY  60
QYPDHLAFLQ AQQQFTQILD DAKNLLSGEG GDMEKMHSDA SLQGIRGGSM CLADKDVPSW  120
TFSDGAEVYN NGDQSKLNRS NEAMLNFAFL KGMEEANKFL PRDNQPQADV FSVDQAKEIF  180
GRSISGGGRK GQRDVDKLEE VVGRASKLLM PELEEDGASE MINKIMLNSY ELCGETMEEL  240
QITMENIRAD RKNKKAVRGK QGKKEAVDLR GLLLCCAQEV ATGNRHGAGN LLKQIRQHAS  300
ATGDAAQRLA YCFAKGLEAR LAGTGSQVYK SLMAKHTSTM EFLKGYELFM AACSFKRVAF  360
TFSSMTIFDA VEGKSKLHIV DYGLHYGCQW PGLLAWLATR DGGPPEVRIT GIDLPQPGFR  420
PAKRLEETGR ALSNCARQFG LPFKFHAIAA KWETIRAEDL NIDPDEVLVV NDLFNFNTLM  480
DESLVIDRPS PRDVVLSNIR EMQADVFVQG VVNGSSGPFF LARFREALFF YSSVFDMLDT  540
TTPPESYERF VLERDMFGQC ALNTIACESA DRVERPETYK QWQLRNQRAG LRQLPLKPII  600
TKVATGKVKS LYHKEFVVDV DQGWLLQGWK GRILYAHSAW VADD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-392736408374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575617.30.0PREDICTED: scarecrow-like protein 9
TrEMBLT1LUM00.0T1LUM0_TRIUA; Uncharacterized protein
STRINGBRADI4G09170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein