PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08697-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 580aa    MW: 65669.4 Da    PI: 6.1495
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08697-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.84.7e-972065782374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av + d ++a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y +l+++ ts    + +  a++ f  ++ + ++s+
  TRIUR3_08697-P1 206 HTLLIHCAKAVMD-DRRRAGELLKEIQQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGTLTAKGTS---AVAHSEAYQEFISACCFRNVSF 295
                      679********97.999**********************************************999999...899999**************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      l aN+aI +a+ g +r+Hi+D++  +G+QW  Ll+ La+R++gpp++RiT ++ p++g   ++ ++e+  rL+++A+elgv+f++++ +  +++
  TRIUR3_08697-P1 296 LFANRAIFNAAVGRSRLHIVDYGFRYGFQWSELLRWLAARDGGPPEVRITHIDLPQPGfhPEKHMKEIDCRLTDIARELGVSFKYRA-ILAQWQ 388
                      *********************************************************9999**************************.6899** PP

             GRAS 188 dleleeLrvkp..gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                      ++++e+L+++   +E+laVn  ++  +l+desv + s  +rd+vL+ + +++P+v+v +  + ++ ++ Fl rf eal +ysalfd+l+a++pr
  TRIUR3_08697-P1 389 TVSIEDLDLDLgpDEVLAVNDLYNFRTLMDESVVIGSpnPRDTVLSNISKMKPDVFVQSTVNGSY-GTFFLSRFREALFFYSALFDMLDATMPR 481
                      *****99877666********************9988779***********************99.789************************* PP

             GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                      e++ r  +Er ++g+ + n++a eg++r+er+et+++W+ r ++aG++++pl+ +++k a+ ++++ + + + ++e++++l++gWk+r L++ S
  TRIUR3_08697-P1 482 ENKLRLALERNIFGWVVLNAIAYEGKDRVERCETYKHWQVRNQRAGLRQLPLDRETVKMARDMVKNKYHKDFLIDEDHHWLLQGWKGRILLAHS 575
                      ******************************************************************99888*********************** PP

             GRAS 372 aWr 374
                       W+
  TRIUR3_08697-P1 576 TWE 578
                      **5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.624179558IPR005202Transcription factor GRAS
PfamPF035141.6E-94206578IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
PRIFPDLPLV AHHDRNRSAM QDHLALPNIA HILMEEDDDI DEDNPALLKA QRPFAQILSS  60
SMPASTLMAD QGGALASDMH SPSSGILKFK GVDEVRSLLL LANGEFSTDI FSTAFLKGME  120
EAKKFLPTNS ELTTTGEQDQ PMEKSSRGRK DWSDEVEADV SRTDRLVEAG ACEVFDFNQM  180
CSSMDNETGN SNKKGRKSKA RVIDLHTLLI HCAKAVMDDR RRAGELLKEI QQHASPTGDA  240
TQRLAYWFAE GLEARLTGTG SQVYGTLTAK GTSAVAHSEA YQEFISACCF RNVSFLFANR  300
AIFNAAVGRS RLHIVDYGFR YGFQWSELLR WLAARDGGPP EVRITHIDLP QPGFHPEKHM  360
KEIDCRLTDI ARELGVSFKY RAILAQWQTV SIEDLDLDLG PDEVLAVNDL YNFRTLMDES  420
VVIGSPNPRD TVLSNISKMK PDVFVQSTVN GSYGTFFLSR FREALFFYSA LFDMLDATMP  480
RENKLRLALE RNIFGWVVLN AIAYEGKDRV ERCETYKHWQ VRNQRAGLRQ LPLDRETVKM  540
ARDMVKNKYH KDFLIDEDHH WLLQGWKGRI LLAHSTWEAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-422095778374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLT1LUL90.0T1LUL9_TRIUA; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-126SCARECROW-like 14