PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08696-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 1256aa    MW: 140501 Da    PI: 6.0872
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08696-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.85.6e-982976542359
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cA+a+s+++ + a++lL+r++++++p+gd+ qRla+yf+eAL arla+ +sely++l +++ts   +++ l+a +l+  ++ + k+++
  TRIUR3_08696-P1 297 HTLLLNCAQALSTDNRRTASELLKRIRQHSTPKGDAAQRLAHYFAEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAACCCKKVAF 387
                      679**************************************************************9999...********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + aN++I +av g++r+Hi+D+++sqGlQWp Ll+ La+R++gpp+++iTg++ p++g   +  +eetg+rL++fA+ +gvpf+f+  +a + e
  TRIUR3_08696-P1 388 IFANKTICNAVVGKSRLHIVDYGLSQGLQWPGLLRMLAAREGGPPEVKITGIDLPQPGfqGAYHIEETGRRLSNFARVFGVPFKFHG-IAAKRE 480
                      *********************************************************9989999***********************.69999* PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++++e+L+++++E+l+V +  +   l+de++ l+   +rd+vL+ +++++P+v+++   + +++++ Fl+rf eal  ysa fd l+a++pr++
  TRIUR3_08696-P1 481 TVQPEDLSIDRDEVLVVISLCHFRLLMDENLGLDTpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATYFLTRFREALFNYSAQFDLLDATVPRDN 574
                      *********************99999999987665559******************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                      e r  +Er ++gr++ nv+aceg++r+er et+++W+ r ++aG++++pl+ +++  +   ++  + + + v+e++ +l+
  TRIUR3_08696-P1 575 EGRLLLERDIFGRSALNVIACEGSDRVERPETYKQWQLRNHRAGLRQLPLNPDVVRLVLDKVKDNYHKDFVVDEDQRWLL 654
                      ***********************************************************9999999888******99985 PP

2GRAS320.14.5e-9887812472373
             GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93  
                        +lL++cA+av + d + a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y  l+++ ts   ++++++a++lf  ++ + k+
  TRIUR3_08696-P1  878 HTLLIHCAKAVMD-DRRSAGELLKEIKQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGLLTAECTS---TVRHMQAYQLFMSTCCFRKV 965 
                       679********97.8999******************************************999998888...899***************** PP

             GRAS   94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183 
                       ++l aN+aI +a+ g +r+Hi+D+++  G+QWp Ll+ LasR++gpp++RiT ++ p +g   ++ +e++g+rL+++A+elgvpf++++ ++
  TRIUR3_08696-P1  966 AFLFANKAIFNAAVGRSRLHIVDYGLHCGFQWPELLRWLASRDGGPPEVRITHIELPLPGvyPEKHMEQIGNRLTDIAQELGVPFKYRA-IM 1056
                       *********************************************************99999***************************.69 PP

             GRAS  184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273 
                        +++++ +e+L+ +p+EalaVn +++  +l+desv ++s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal y+salfd+l+a
  TRIUR3_08696-P1 1057 AQWQTICVEDLDKEPDEALAVNDQFNFRTLMDESVVIASpnPRDAVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREALFYHSALFDMLDA 1147
                       99*********************************9998889***********************99.789********************* PP

             GRAS  274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365 
                       ++pres+ r  +Er ++g+ + n+va eg++r+er et+++W+ r ++aG++++pl+ +++k a  ++   + + + ++e++++l++gWk+r
  TRIUR3_08696-P1 1148 TMPRESKLRLALERDVFGWMVLNAVAYEGEDRVERGETYKHWQIRNQRAGLRQLPLNRETVKMATDMVMGDYHKDFDIDEDHQWLLQGWKGR 1239
                       *************************************************************99998888877677***************** PP

             GRAS  366 pLvsvSaW 373 
                        L++ S W
  TRIUR3_08696-P1 1240 ILYAHSTW 1247
                       ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.018270649IPR005202Transcription factor GRAS
PfamPF035141.9E-95297654IPR005202Transcription factor GRAS
PROSITE profilePS5098555.7258511228IPR005202Transcription factor GRAS
PfamPF035141.6E-958781247IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1256 aa     Download sequence    Send to blast
MAATPEEFLG QQSFLSRLEP PSPSLFLGLP PTPRGVEDGD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF VQILVDVADS ASGSTSALSP SSSTSTFDAT ASTTPSATSP  120
YDAAIQISRP PYAEVLGLAS GSPDTQSSAL LSGDEEAQNP SSDFVIGNYL LPGDQDMLNL  180
AFLKGMEEAR KFLPPNSSLP AMKVDQVVAG VHAGAGLKKK RDTLEPDMGR ASKLMMPEQE  240
EDGARELFDE MMFQEHEICM KGVQQLRVAV DSEPGKNRRK KGRPRRDSSD SEMVDLHTLL  300
LNCAQALSTD NRRTASELLK RIRQHSTPKG DAAQRLAHYF AEALDARLAG RGSELYQSLM  360
ARRTSVADFL KANQLYMAAC CCKKVAFIFA NKTICNAVVG KSRLHIVDYG LSQGLQWPGL  420
LRMLAAREGG PPEVKITGID LPQPGFQGAY HIEETGRRLS NFARVFGVPF KFHGIAAKRE  480
TVQPEDLSID RDEVLVVISL CHFRLLMDEN LGLDTPSPRD QVLNNIRKMR PDVFIHGIMN  540
GSYGATYFLT RFREALFNYS AQFDLLDATV PRDNEGRLLL ERDIFGRSAL NVIACEGSDR  600
VERPETYKQW QLRNHRAGLR QLPLNPDVVR LVLDKVKDNY HKDFVVDEDQ RWLLHRKSFA  660
ITIVIAITKA ATPVFPVFPD LPLMADDDSN CFAVQDHLAL PYITQILMEE EDDVDEDSPA  720
LLKAQRPFAQ ILSSSMHAST LMADQGGALA IDVHSPSSPI FKFKGVDEVH SLMLLPDADY  780
STHMFSIAFL RGMEEANKFL PRNCELTTTG GHDQPKEKSG RGRKDRHGEV EADVSRTSRL  840
VEVGAGEVFD QMLIAHGNET GNSNKKGRKS KTRVVDLHTL LIHCAKAVMD DRRSAGELLK  900
EIKQHASPTG DATQRLAYWF AEGLEARLTG TGSQVYGLLT AECTSTVRHM QAYQLFMSTC  960
CFRKVAFLFA NKAIFNAAVG RSRLHIVDYG LHCGFQWPEL LRWLASRDGG PPEVRITHIE  1020
LPLPGVYPEK HMEQIGNRLT DIAQELGVPF KYRAIMAQWQ TICVEDLDKE PDEALAVNDQ  1080
FNFRTLMDES VVIASPNPRD AVLGNISKMK PDVFVQSTVN GSYGTFFLSR FREALFYHSA  1140
LFDMLDATMP RESKLRLALE RDVFGWMVLN AVAYEGEDRV ERGETYKHWQ IRNQRAGLRQ  1200
LPLNRETVKM ATDMVMGDYH KDFDIDEDHQ WLLQGWKGRI LYAHSTWVAE GASSHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4230012478374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLM8AML10.0M8AML1_TRIUA; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-123GRAS family protein