PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_08319-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 289aa    MW: 31692.8 Da    PI: 8.4963
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_08319-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.5e-094302047
                     TTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 20 GggtWktIartmgkgRtlkqcksrwqky 47
                     G ++W+tIar ++ gR++k+c++rw + 
  TRIUR3_08319-P1  4 GARNWTTIARGIP-GRSGKSCRLRWCNQ 30
                     6789*********.***********985 PP

2Myb_DNA-binding55.51.3e-173781147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r+++T+eEd+ ++ a++ +G++ W++Ia+ +  gRt++ +k++w++ 
  TRIUR3_08319-P1 37 RKPFTEEEDQMIISAHAIHGNK-WASIAKLLV-GRTDNAIKNHWNST 81
                     789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.287131IPR017930Myb domain
CDDcd001672.00E-6429No hitNo description
PfamPF002492.2E-7430IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-17438IPR009057Homeodomain-like
SMARTSM0071752433IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-251186IPR009057Homeodomain-like
PROSITE profilePS5129426.4273286IPR017930Myb domain
SMARTSM007171.0E-163684IPR001005SANT/Myb domain
PfamPF002497.1E-163781IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-243985IPR009057Homeodomain-like
CDDcd001673.30E-133982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MRDGARNWTT IARGIPGRSG KSCRLRWCNQ LDPQLKRKPF TEEEDQMIIS AHAIHGNKWA  60
SIAKLLVGRT DNAIKNHWNS TLRRRYCTGT RCTRSASAEQ PMREMSRAVS EERWPLSGPS  120
SFSVMEVKEA PVQTVSETSA GALQIRDINN CSTEAVDRSY PVRPVATVGA FRPYSLGPAQ  180
QMQMEMSSST KFVPTIQALT PEIAVSKFAD TTCFAADVPN KCGHGCCSAE EQPRNNSLLG  240
PEFKEFIDHP PILSSSFASL VSEISSIAWM NGGLQSSNSG NLVQSNPPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3148826110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
GenBankFN5644270.0FN564427.1 Triticum aestivum chromosome 3B-specific BAC library, contig ctg0079b.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645018.11e-140PREDICTED: uncharacterized protein LOC102712209
TrEMBLD8L9H60.0D8L9H6_WHEAT; Myb-like DNA-binding domain containing protein,expressed
TrEMBLM7Y5700.0M7Y570_TRIUA; Transcription factor MYB44
STRINGMLOC_10322.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.16e-64myb domain protein 109