PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_07949-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 423aa    MW: 47471.3 Da    PI: 5.3718
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_07949-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65.2e-07262352347
                      SS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqky 47 
                      +W+  E ++l++++kq   +                                              +W+ Ia++   gR++ +c srw++y
  TRIUR3_07949-P1 262 SWSDTEKDRLAKGIKQQYQEmlikdsmkngsssgdfsavdmayaltnaggnfeatpeilrsvlplvNWDYIAAMYLPGRSGAECESRWLNY 352
                      699999999999999999889999999999999999999999999999999*********************99888************98 PP

2Myb_DNA-binding25.62.9e-08360404246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  TRIUR3_07949-P1 360 NAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 404
                      68*****************************99**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.307255353IPR017877Myb-like domain
SMARTSM007170.27259355IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-11262278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-11325360IPR009057Homeodomain-like
SuperFamilySSF466891.03E-17334415IPR009057Homeodomain-like
PROSITE profilePS5129410.191354410IPR017930Myb domain
SMARTSM007178.5E-4358408IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-10361409IPR009057Homeodomain-like
PfamPF139214.9E-7362410No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MAPAPRGLDQ IAQGSARLRT IATTGASAAA SVDLNSDDDS DSEFDEDLQE DLDLEEEDED  60
LALVRSIREN LHLNKASPSS PRPICIWPPS DTEDDEEDGL ETLRAIQRRF SHYHSGETTH  120
DPVLPSSSLE VPGTSTGPLE NMKNEASKEG DDEFIAHRPG EEDVQNKNMK ALTQTGFPKA  180
ALLLVDALKK NRACQKFIRR KMINIEAKIE VNKDLRDRVK CLMDYQLSCR RSFSNFLCHK  240
VDPRVRLISS KKQTAQSAMK HSWSDTEKDR LAKGIKQQYQ EMLIKDSMKN GSSSGDFSAV  300
DMAYALTNAG GNFEATPEIL RSVLPLVNWD YIAAMYLPGR SGAECESRWL NYDDPLINHN  360
AWTACEEKRL ILTVQEKGMH NWINIAVALG TQRTPFQCLA RYQRSLSPHI LKYSSTPKTQ  420
VVD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228413.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X1
RefseqXP_010228416.10.0PREDICTED: snRNA-activating protein complex subunit 4 isoform X4
RefseqXP_014752710.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X1
RefseqXP_014752711.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X2
TrEMBLM7ZP920.0M7ZP92_TRIUA; Myb-like protein L
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.12e-58myb domain protein 4r1