PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_06726-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 216aa    MW: 24078.3 Da    PI: 10.0235
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_06726-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.6e-15164206547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk
  TRIUR3_06726-P1 164 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK 206
                      79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.4E-15157207No hitNo description
SMARTSM003383.0E-11160215IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702162207IPR004827Basic-leucine zipper domain
CDDcd147071.98E-25164214No hitNo description
PfamPF001704.5E-13164207IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-11164207No hitNo description
PROSITE patternPS000360167182IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MPPELSKKTV DEVWKGIQDS PKRSGEEGSR RRRERQPTFG EMTLEDFLVK AGVVAEGHLK  60
DPIDLPANMG AVGSSVIEAA APSLNPGAHW LQQYLEPQHP RMAGPFMASH LGPQPLSVAT  120
GAIMEPIYPD GQITSPMLDA LSDPQTARRK RGASDGVTDK VVERRQKRMI KNRESAARSR  180
ARKQAYTNEL ENKVSRLEEE NERLKKQKVV SYFVSH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11823DSPKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071120.0EU307112.2 Triticum aestivum FD-like 2 protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568219.11e-107PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014753472.11e-107PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES34e-47AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM7Z3871e-159M7Z387_TRIUA; ABSCISIC ACID-INSENSITIVE 5-like protein 2
STRINGMLOC_6534.11e-126(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.16e-45ABA-responsive element binding protein 3