PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_06177-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 677aa    MW: 73511.3 Da    PI: 4.5723
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_06177-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS64.22.6e-20367454191
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                      l++ L++cA+av++gd + a++lL ++++++ p+gd++qRla++f+e+L+arla+++s++y++l +++ts   ++e l+a+klf  ++ + 
  TRIUR3_06177-P1 367 LRTMLIHCAQAVAAGDRRGATELLRQIKQHSGPTGDATQRLAHCFAEGLEARLAGTGSQVYQSLVAKRTS---VVEFLKAYKLFMAACCFK 454
                      5789***************************************************************999...************999665 PP

2GRAS120.81.7e-37457617164322
             GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvveqeadhnsesF 253
                      +  + A+elgvpf+f+  va ++++++ e+Lr++p+E+l+V+++  l +l+d+sv+++     +rd vL+ +++++P+v+v +  +  ++++ F
  TRIUR3_06177-P1 457 NFGSCARELGVPFKFHG-VAAKWDTVRGEDLRIDPDEVLVVHCQCGLRNLMDDSVAVTTssssPRDVVLRNIRDMKPDVFVECVANGGYGAPFF 549
                      55678************.799******************************9998765545669****************************** PP

             GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                      ++rf eal +ysa fd l+a++pr+++er ++Er l+gr + nv+acega+r+  +  ++kW++ +++a
  TRIUR3_06177-P1 550 VTRFREALFFYSAHFDILDATIPRDNDERLMIERDLIGRGALNVIACEGADRVL-TGGVKKWSDIISTA 617
                      ***************************************************765.566999*9988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098511.059341451IPR005202Transcription factor GRAS
PfamPF035149.0E-18367454IPR005202Transcription factor GRAS
PfamPF035145.8E-35457617IPR005202Transcription factor GRAS
PROSITE profilePS5098515.174462656IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MDEEFSPLSP SLFLDLPPTP PPAADVDLDF ISRMLMEEDI DDKFFYQYPD QPAILDAQRP  60
YQQIISDTTT TSSGSPNGTT SSCSPNGTTF SDGNAMSSSN AATSSSEETN NFSWPYDPLE  120
LSQLLRSPPY LDDMLFGGLV PDSPADEDTR NSFVADAPAA GFQQSPPQFK GAANGAGAFF  180
GQNGGSPGTQ SSAVLNGPAE EKEAERKPAM FSAGDGGQGG LLSAFFSNGG DMDMLNSACL  240
KGMEEANKFL PTNNTLLEAI PGKEKERGFI VKKEEAANGT PTSGNGRRGR KYRYEEDDLD  300
AETARSSKLM MPDSEETGAR EMFDEIMLEG YETCMRGIEE LRLAMDSEAK KKNGKAARAK  360
KSEVVDLRTM LIHCAQAVAA GDRRGATELL RQIKQHSGPT GDATQRLAHC FAEGLEARLA  420
GTGSQVYQSL VAKRTSVVEF LKAYKLFMAA CCFKKANFGS CARELGVPFK FHGVAAKWDT  480
VRGEDLRIDP DEVLVVHCQC GLRNLMDDSV AVTTSSSSPR DVVLRNIRDM KPDVFVECVA  540
NGGYGAPFFV TRFREALFFY SAHFDILDAT IPRDNDERLM IERDLIGRGA LNVIACEGAD  600
RVLTGGVKKW SDIISTASTA VGLDGMAQRD LGDGCAQDGC DVSRRGTTRS RLKDGMSSWI  660
DNARIIIELY HFLPSDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM7Z5910.0M7Z591_TRIUA; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.15e-40GRAS family protein