PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_05951-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 644aa    MW: 71951.7 Da    PI: 5.2547
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_05951-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.61.1e-962696402373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cAeav+s+d   a++lL+r++ ++sp+gd+ qRla+yf+++L+arla+++s+ly++l  ++ts    +e + a+ l   +s  +k++ 
  TRIUR3_05951-P1 269 ETLLTRCAEAVASSDVCGASKLLERIKCHSSPRGDARQRLAHYFAQGLEARLAGTGSRLYRSLMGKRTS---AVELIRAYYLHTAASCSIKVGL 359
                      689************************************************************999998...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      l   ++I++av+g +++Hi+ ++is G+QWp Ll+ La+R++gpp++ iTg++ p++g   +  +e+ g+rL++ A++lgvpf+f++ +a++le
  TRIUR3_05951-P1 360 LFSTNTIYKAVAGRRKLHIVHYGISTGFQWPDLLRLLANREGGPPEVTITGINTPQPGpcPAALMEQAGDRLSNCASQLGVPFKFRA-IASKLE 452
                      **********************************************************999999***********************.7***** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      d++ e+L+++p+E+l+V++ ++  +l+des++ +   +rd vL+++++++P v++ +  +  ++++ F++rf +al++++alfd +e+++pr+s
  TRIUR3_05951-P1 453 DVQAEDLHIDPDEVLVVSSLYEFRTLMDESLTFDMvsPRDMVLNTIRKMRPSVFISSVVNGPYSAAFFMTRFRHALYHFTALFDVMETTVPRDS 546
                      *****************************98765555********************************************************* PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      ++r  vEr +l+r++ n++acega+r+er +++++W++r ++aG++++pl+ +++   k  +++ + + +++ e++ +l++gWk+r  ++ S W
  TRIUR3_05951-P1 547 DKRLLVERDILARSAINMIACEGADRVERPQNYKEWQARNQRAGLRQLPLDPDIVLMLKDEVKNWHHKHFMISEDHRWLLQGWKGRVQYAHSTW 640
                      ******************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.769242621IPR005202Transcription factor GRAS
PfamPF035143.8E-94269640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MAATPEELLG LAEPAPLSPS LFLDLPPMTH GDSQNDLALE YISRVLTEED IVDKFFYQYP  60
DHPKLLQAEQ SFAEILANTS PTADQESFAS STSILMPSQG NNTDVMVSGC QVQDPALLNC  120
TGTVEPNSMV FPSESSTNMN MLSSMSMAFF NGMEDANRFL PADDVMMDGR GRKKRSDMDG  180
EMEAGLGRSS KQIVVVLHSA LEEEEEEEEE ATALEMLDRL ILNGYEASPS EMQEVVRVTW  240
EDKEDKAARQ SISRRGRCAA RHTVVTDLET LLTRCAEAVA SSDVCGASKL LERIKCHSSP  300
RGDARQRLAH YFAQGLEARL AGTGSRLYRS LMGKRTSAVE LIRAYYLHTA ASCSIKVGLL  360
FSTNTIYKAV AGRRKLHIVH YGISTGFQWP DLLRLLANRE GGPPEVTITG INTPQPGPCP  420
AALMEQAGDR LSNCASQLGV PFKFRAIASK LEDVQAEDLH IDPDEVLVVS SLYEFRTLMD  480
ESLTFDMVSP RDMVLNTIRK MRPSVFISSV VNGPYSAAFF MTRFRHALYH FTALFDVMET  540
TVPRDSDKRL LVERDILARS AINMIACEGA DRVERPQNYK EWQARNQRAG LRQLPLDPDI  600
VLMLKDEVKN WHHKHFMISE DHRWLLQGWK GRVQYAHSTW AAGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-382686405374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLT1LM950.0T1LM95_TRIUA; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein