PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_05949-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 557aa    MW: 62667.1 Da    PI: 5.5013
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_05949-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS313.74.1e-961815512374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av + d ++a +lL ++++ asp gd +qRla  f+e+L++ l++++s++y  l++++ts      +  a+++f  ++ + ++s+
  TRIUR3_05949-P1 181 HTLLIHCAKAVVD-DRRRAGELLMEIQQYASPIGDGTQRLAYWFAEGLESWLTGTGSQVYGMLTAKATS---AMAHSEAYQVFISTCCFRNVSF 270
                      679********97.899**********************************************999999...7888899*************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      l aN+aI +a+ g +r+Hi+D++ s+G+QWp Ll+ La+R++g+p++RiT ++ p++g    + +ee+g+rL+++A+el+vpf++++ +  +++
  TRIUR3_05949-P1 271 LFANRAIFNAAVGRSRLHIVDYGFSYGFQWPELLRWLAARDGGSPEVRITHIDLPQPGlhPGKHMEEIGNRLTDIARELDVPFKYRA-ILAEWQ 363
                      *********************************************************9999**************************.6999** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++ +e+L+++p+E+laVn  ++  +l+de v + s  +rd vL+ + +++P+v+v +  + +h ++ Fl rf  al +ysalfd+l+a++pres
  TRIUR3_05949-P1 364 TVCIEDLDLEPDEVLAVNDLYNFRTLMDECVVMGSpnPRDVVLSNISKMKPDVFVQSTVNGSH-GTFFLSRFRGALFFYSALFDMLDATMPRES 456
                      ******************************99988779************************9.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      + r  +Er+++g+ + n++a eg++r+er et+++W+ r ++aG++++pl+++++k a+ ++++ + + + ++e++++l++gWk+r L++ S W
  TRIUR3_05949-P1 457 KLRLALERAVFGWVVLNAIAYEGKDRVERGETYKHWQVRNQRAGLRQLPLDSETVKMARDMVKNEYHKDFVINEDHQWLLQGWKGRILLAHSTW 550
                      ****************************************************************99888************************* PP

             GRAS 374 r 374
                      +
  TRIUR3_05949-P1 551 E 551
                      5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.968154531IPR005202Transcription factor GRAS
PfamPF035141.4E-93181551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
LSLPYITQIL MEEEDDVDED NPALLKAQQP FAQILSMHAS TLMADKGSAL ASDVHSPSSA  60
IFKFKGVDEV RSLLLLANGE YNTHIFSTAF LKGMEEAKKL LPTNCELTAT GEQDQPKEKS  120
GIGHKDSSDE VEADVSRTNR LVEARACEVF DFDQMCSSMD NESGNSNKKG RKSKARVIDL  180
HTLLIHCAKA VVDDRRRAGE LLMEIQQYAS PIGDGTQRLA YWFAEGLESW LTGTGSQVYG  240
MLTAKATSAM AHSEAYQVFI STCCFRNVSF LFANRAIFNA AVGRSRLHIV DYGFSYGFQW  300
PELLRWLAAR DGGSPEVRIT HIDLPQPGLH PGKHMEEIGN RLTDIARELD VPFKYRAILA  360
EWQTVCIEDL DLEPDEVLAV NDLYNFRTLM DECVVMGSPN PRDVVLSNIS KMKPDVFVQS  420
TVNGSHGTFF LSRFRGALFF YSALFDMLDA TMPRESKLRL ALERAVFGWV VLNAIAYEGK  480
DRVERGETYK HWQVRNQRAG LRQLPLDSET VKMARDMVKN EYHKDFVINE DHQWLLQGWK  540
GRILLAHSTW EADGGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-401845508374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLT1LM930.0T1LM93_TRIUA; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-123GRAS family protein