PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_05615-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 268aa    MW: 28986.3 Da    PI: 4.8865
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_05615-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.3e-121462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd +l   v+++ +  +W t +++ g++R++k+c++rw++yl
  TRIUR3_05615-P1 14 RGAWSREEDAILTGFVQRFANAgNWMTLPHKAGLNRCGKSCRLRWLNYL 62
                     89******************999************************97 PP

2Myb_DNA-binding45.12.3e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd l++ + +  G++ W+ Ia++++ gRt++++k++w++
  TRIUR3_05615-P1  69 GQFTDEEDSLILSLYADIGSK-WSVIAAKLP-GRTDNDVKNHWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5009010.58962IPR017877Myb-like domain
SuperFamilySSF466891.75E-2511109IPR009057Homeodomain-like
SMARTSM007171.0E-61364IPR001005SANT/Myb domain
PfamPF002496.5E-101462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-191569IPR009057Homeodomain-like
CDDcd001677.83E-51662No hitNo description
PROSITE profilePS5129421.51663117IPR017930Myb domain
SMARTSM007173.8E-1267115IPR001005SANT/Myb domain
PfamPF002497.1E-1369111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2270116IPR009057Homeodomain-like
CDDcd001672.93E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRSPCCDRR SVKRGAWSRE EDAILTGFVQ RFANAGNWMT LPHKAGLNRC GKSCRLRWLN  60
YLRPALRHGQ FTDEEDSLIL SLYADIGSKW SVIAAKLPGR TDNDVKNHWN TKLKKRHLLA  120
MAPSPTPPTP ATDSPSASDA DESSLPPPPL DEEALATVDD GGELKHRSEE LYAELMGLIQ  180
QQPMTGDVRS SSSSSLSSTP TAGASSAGVS SAAWSVDDEE FLPESSGSSM VVDLHDPCAA  240
HAFGATSFQD LLASSYDEII GTEGLLYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644640.12e-94PREDICTED: transcription factor RAX2-like
TrEMBLM7YIG40.0M7YIG4_TRIUA; Transcription factor RAX2
STRINGOB01G38240.16e-94(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.14e-60MYB family protein