PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_03772-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 331aa    MW: 36545.9 Da    PI: 5.0541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_03772-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W++ ++  g++R++k+c++rw +yl
  TRIUR3_03772-P1 14 KGPWTPEEDQKLTDYIEKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.41.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  TRIUR3_03772-P1  67 RGKFTPEEEQTILQLHSVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.094961IPR017930Myb domain
SuperFamilySSF466893.02E-3311108IPR009057Homeodomain-like
SMARTSM007179.9E-161363IPR001005SANT/Myb domain
PfamPF002491.5E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-261568IPR009057Homeodomain-like
CDDcd001679.84E-131661No hitNo description
PROSITE profilePS5129428.38762116IPR017930Myb domain
SMARTSM007177.6E-1866114IPR001005SANT/Myb domain
PfamPF002491.5E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2969117IPR009057Homeodomain-like
CDDcd001676.98E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLTDYIE KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TPEEEQTILQ LHSVLGNKWS AIAKHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DFFAALPQLI ALANLRQLVE QRPWDDQSAS QLQADAVQAA KLEYLQCLLQ  180
SAAAIATSPS SSSINTIPTD LQQIGLLSPS QMSSLSSLSS PRILEGINGQ DLVTGQVSDI  240
QIPSSSFFEH EQPIINGTNQ NSDYSANSGE GENGTQKPLL LSEDSLPPLA DFPISNLGDA  300
CSTSSCDAEG NGTQLPIWSD SFYDEFMSEF A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570617.10.0PREDICTED: transcription factor MYB39-like
TrEMBLW5G5Z00.0W5G5Z0_WHEAT; Uncharacterized protein
TrEMBLM7ZVU90.0M7ZVU9_TRIUA; Transcription factor MYB39
STRINGMLOC_52134.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-104myb domain protein 93