PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_03304-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 324aa    MW: 35934.3 Da    PI: 6.5846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_03304-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEde+l  +++++G g+W++ ++  g++R++k+c++rw +yl
  TRIUR3_03304-P1 14 KGPWTTEEDEKLMSYIQKHGHGSWRALPQLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding582.1e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  TRIUR3_03304-P1  67 RGKFSQEEEQTILQLHTVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.581961IPR017930Myb domain
SuperFamilySSF466893.44E-3211108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002493.0E-171461IPR001005SANT/Myb domain
CDDcd001673.06E-111661No hitNo description
PROSITE profilePS5129427.41762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2865117IPR009057Homeodomain-like
SMARTSM007179.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667112IPR001005SANT/Myb domain
CDDcd001675.07E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRPPSSDEN GLKKGPWTTE EDEKLMSYIQ KHGHGSWRAL PQLAGLNRCG KSCRLRWTNY  60
LKPDIKRGKF SQEEEQTILQ LHTVLGNKWS AIAKHLPGRT DNEIKNFWNT HLRKKLIKMG  120
IDPMTHRPRT DFFAALPQLI ALANLRQFIN QQPWDDHTAG LQAQTAQAAN LQYVQSLLHS  180
AASIAASPTT SSSLNGLTMD LEQINFLSPP QMLSPSVLEG NGGIDLAGQV AQNQMPSITF  240
DHTIGNINPG SDNHVETSGQ HRSEEENNSK KRQFLSENSL PPLTDMAASN ICNTISTSNC  300
DGVSSPFPSW SEILLDEELL SEFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-30121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-301211625128MYB TRANSFORMING PROTEIN
1mse_C3e-30121162105C-Myb DNA-Binding Domain
1msf_C3e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3304820.0KP330482.1 Triticum aestivum MYB transcription factor SM152-3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560902.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLM7ZEE10.0M7ZEE1_TRIUA; Transcription factor MYB39
STRINGMLOC_51960.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-91myb domain protein 93