PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_02784-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 490aa    MW: 52321.4 Da    PI: 10.3739
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_02784-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1408.8e-131574362
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                     + +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++ +  e a+l+++
  TRIUR3_02784-P1 15 DTRRAARLIRNRESAQLSRQRKKRYVEELEEKVKSMNSVINDLNSKISFIVAENATLRQQ 74
                     6799***********************************99******9999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-131377IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0361575IPR004827Basic-leucine zipper domain
PfamPF001704.0E-121575IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.29E-121775No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-151775No hitNo description
CDDcd147041.12E-191869No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
AGDAGEGGAG GEGEDTRRAA RLIRNRESAQ LSRQRKKRYV EELEEKVKSM NSVINDLNSK  60
ISFIVAENAT LRQQLGSGGG NCPPPGMYPP GAVPGMHFPW VPGYAMRPHG SHVPLVPIPR  120
LKPQQQVTAT KATKKPENKK AAESKSKSKT KTKKVASVSL LGLMLVMLVF GAFVPGFNHN  180
FGLSGGSDNA MFRNFGQPHD RVVNVNNHGQ APKGGLNNSD MTGVDSGMMI GTDGSADQKH  240
QPPLNSSETL PALLYVPRNG KHVKINGNLI IHSVLASEKA VAHGTSQHNR DQSGIDHKET  300
SPAIARHLSL PGNNMNPQEK SPVDGPLPQW FREGMAGPIL NSGMCSEVFQ FDISAATNSG  360
GIIPASPAVN SSSVNATRKV PTPAPAYYGK LKNRRIMYNE AIPLTGKTAN NTGPFNRTSE  420
SSKLPDKKPA SSVVVSVLAD PREAGDGDSD PRMTPKSLSR IFVVVLLDGV RYVTYSCTLP  480
FKGASPHLVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3626280.0AK362628.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2008O22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568456.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222081e-102BZP17_ARATH; bZIP transcription factor 17
TrEMBLT1LDX70.0T1LDX7_TRIUA; Uncharacterized protein
STRINGMLOC_42759.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.14e-89bZIP family protein