PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_02309-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 314aa    MW: 34468 Da    PI: 6.8561
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_02309-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.11e-15701511498
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                        lvlp kf++e +g + ++++l++     r W+v++  + +++++ l++GWkeFv+ang++ g  +vF +dg   + l+vkvf+
  TRIUR3_02309-P1  70 EKLVLPDKFVSELNGLELRGVKLRVDGGGARAWDVEVVANEHGDMH-LGRGWKEFVRANGIELGQLLVFCYDG--AALLTVKVFD 151
                      569**********88889999***999999*******767776665.999********************987..5557999998 PP

2B3421.7e-132153021195
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTE.....EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEE CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgr.....yvltkGWkeFvkangLkegDfvvFkldgr.sefelvvk 95 
                       k++ l +p +f ++hg  +++   ++    +g++W+v l++  r  +++     + l+ GW++F  +ngL++gD++ F+l ++  +  +v++
  TRIUR3_02309-P1 215 KKKQYLNVPVEFSQSHGFTEKGR--VV-LRMRGQQWSVCLKHsnR--RKGnartrTALRYGWNQFRVDNGLRVGDICFFQLLQDaGGDDPVLS 302
                      5677899*********8876553..44.45599*****9988652..333346779************************9988677666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.28157153IPR003340B3 DNA binding domain
SuperFamilySSF1019361.18E-1558155IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-1658154IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.4E-559153IPR003340B3 DNA binding domain
PfamPF023622.7E-1368151IPR003340B3 DNA binding domain
CDDcd100175.02E-1471151No hitNo description
Gene3DG3DSA:2.40.330.102.4E-20201309IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-14202293IPR015300DNA-binding pseudobarrel domain
CDDcd100172.46E-12202307No hitNo description
SMARTSM010193.6E-4203309IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111205309IPR003340B3 DNA binding domain
PfamPF023627.1E-11215301IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAVWVLRWAM DVGRRRPFFF LVGGRSCFAR ADGPAAVLDR DTETAEMAQG SPDLAGFQFY  60
KLMAAGMSWE KLVLPDKFVS ELNGLELRGV KLRVDGGGAR AWDVEVVANE HGDMHLGRGW  120
KEFVRANGIE LGQLLVFCYD GAALLTVKVF DDSECGRHCC QREEEDDSAE EEESPPPALP  180
GSGSSSSDGV VHGGGGGAAP SRFTVTLGQC HLGTKKKQYL NVPVEFSQSH GFTEKGRVVL  240
RMRGQQWSVC LKHSNRRKGN ARTRTALRYG WNQFRVDNGL RVGDICFFQL LQDAGGDDPV  300
LSVEVRKADG TIVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-144HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020172157.11e-165B3 domain-containing protein Os03g0212300-like
TrEMBLT1LCN00.0T1LCN0_TRIUA; Uncharacterized protein
STRINGTRIUR3_02309-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47483264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.12e-08B3 family protein