PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_02252-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 205aa    MW: 23765.5 Da    PI: 8.0716
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_02252-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.41e-241058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA+ELSvLCda++ v++fs++gk+ye +
  TRIUR3_02252-P1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVMVFSPHGKVYELA 58
                     8*********************************************965 PP

2K-box59.61.3e-2080176499
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      ++g+s e++k e  qqe+  L++ei+ Lq+ +R + Ge d++ ++l+eLq Le++Le  + +iR +K++++ ++ie l+ ke  l+ +n  L++
  TRIUR3_02252-P1  80 AHGESSEQNKPEVIQQEVLLLRQEIDLLQKGLRYMYGEnDINHMNLNELQALESNLEIWVHNIRYTKMQIISREIEMLKTKEGILKAANDILQE 173
                      45667899999**************************978****************************************************99 PP

            K-box  97 kle 99 
                      ++ 
  TRIUR3_02252-P1 174 RII 176
                      875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.31E-26177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.931161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-35160IPR002100Transcription factor, MADS-box
CDDcd002658.31E-37277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-253859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-2384175IPR002487Transcription factor, K-box
PROSITE profilePS5129712.88290182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVMVFSP HGKVYELATN  60
GCIRNMQGLI ERYKGSNTEA HGESSEQNKP EVIQQEVLLL RQEIDLLQKG LRYMYGENDI  120
NHMNLNELQA LESNLEIWVH NIRYTKMQII SREIEMLKTK EGILKAANDI LQERIIEQSG  180
ILDTGSNMMM PQFPFQRTME GGYYF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2500310.0AK250031.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf65p11, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-147MADS-box transcription factor 26-like
RefseqXP_020194478.11e-147MADS-box transcription factor 26-like
SwissprotA2YQK91e-76MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-76MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A446L5571e-150A0A446L557_TRITD; Uncharacterized protein
TrEMBLM8AK471e-150M8AK47_TRIUA; MADS-box transcription factor 26
TrEMBLN1QUD01e-150N1QUD0_AEGTA; MADS-box transcription factor 26
STRINGEMT026991e-151(Aegilops tauschii)
STRINGTRIUR3_02252-P11e-151(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-58AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]