PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_01653-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 182aa    MW: 20010.5 Da    PI: 7.3442
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_01653-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.17.8e-0878124551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       + rr   NR A r++R++Kk+ ++ L+e+++ L a N++L k+++ 
  TRIUR3_01653-P1  78 SKKRRPLGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQD 124
                      57889999*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-774141IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-1376142No hitNo description
PROSITE profilePS502178.74976123IPR004827Basic-leucine zipper domain
PfamPF077164.6E-1278123IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-679125No hitNo description
CDDcd146865.70E-1079124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MDDGNLDCSS MGSYFDDILM DTEQVACTHT HTCNPPAHHL PHTHTCLHVH SKFAASASSD  60
AGAETPAEFE DAHATSRSKK RRPLGNRAAV RKYREKKKEH TAVLQEEAAR LRAMNEQLTK  120
KVQDHAALEA EAARLRCLLV DVRGRIEGEI GAFPYQRRPA KGAGQGGAQI YAMENIIPEV  180
VA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19098RKYREKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3547351e-170AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.11e-71PREDICTED: uncharacterized protein LOC100823660
SwissprotQ8VY764e-55BZP19_ARATH; Basic leucine zipper 19
TrEMBLM7YXJ71e-134M7YXJ7_TRIUA; Uncharacterized protein
STRINGBRADI1G30140.14e-71(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.13e-49bZIP family protein