PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_01098-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 289aa    MW: 31748.5 Da    PI: 6.5806
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_01098-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l+  ++++G g+W++ +++ g+ R++k+c++rw +yl
  TRIUR3_01098-P1 14 KGPWTSEEDEKLLAHIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.35.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia ++  +Rt++++k++w+++l
  TRIUR3_01098-P1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLS-RRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129416.474961IPR017930Myb domain
SuperFamilySSF466891.91E-2911108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001677.43E-111661No hitNo description
PROSITE profilePS5129425.18962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002495.0E-1567112IPR001005SANT/Myb domain
CDDcd001672.17E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTSE EDEKLLAHIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLSRRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKATN GAPAGTAADP WQGAKLDLES PTSTLTFIGN NNSVSLGASE SNSAMWKLRS  180
DDLECEENSV RKFLREQQMQ GLEGAERGEH IIGCEEPWFQ GTVGVGAGFT DMLHDTLDCW  240
GESSNGQAEL SGQVSGDGES GSSSYWSGIL GMVVTSELPP SHPHPPAFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25121165108B-MYB
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583250.0AK358325.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1073M23.
GenBankAK2486510.0AK248651.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf180h20, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574525.11e-142PREDICTED: myb-related protein Myb4-like
SwissprotQ9SPG23e-66MYB28_ARATH; Transcription factor MYB28
TrEMBLM8AQR80.0M8AQR8_TRIUA; Transcription factor MYB39
STRINGBRADI3G36660.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.17e-87myb domain protein 16