PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA9575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 165aa    MW: 19577.8 Da    PI: 6.5439
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA9575genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.11.3e-264494252
                    RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                              +k++s +++s+yF++pi +AAkeL+++lT+LK++CR++GI RWPhRk++sl
  Tp57577_TGAC_v2_mRNA9575 44 TKSLSRDTISQYFYMPISQAAKELNIGLTLLKKRCRELGIGRWPHRKLTSL 94
                              799*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.89428115IPR003035RWP-RK domain
PfamPF020429.6E-224794IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MFDILFDSEK EHLCCTDIEI KKEVVEFKPE VEERKKITIS GEDTKSLSRD TISQYFYMPI  60
SQAAKELNIG LTLLKKRCRE LGIGRWPHRK LTSLQTLINN VQELREEEEP LSDEKLMNVI  120
EMLEKEKKLV EEMPDMELDY RTKRLRQACF KANYKKRKLM EQVF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA9575
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028753648.17e-59protein RKD2
SwissprotQ9M9U92e-48RKD1_ARATH; Protein RKD1
TrEMBLA0A2K3L3Q81e-112A0A2K3L3Q8_TRIPR; Protein RKD1
STRINGGLYMA05G01030.25e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.18e-40RWP-RK domain-containing protein