PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA9555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 237aa    MW: 26919.6 Da    PI: 6.617
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA9555genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like22.91.9e-07145166122
                   G2-like   1 kprlrWtpeLHerFveaveqLG 22 
                               k rl Wtp+L ++F+ av+qLG
  Tp57577_TGAC_v2_mRNA9555 145 KSRLSWTPDLDKQFLTAVNQLG 166
                               68*******************7 PP

2Response_reg357.4e-1399912106
                               HHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESE CS
              Response_reg  12 ellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakd 96 
                                 +r +++   y +v ++ + ++a ++l ++++D+il+  +mp  d ++++ +i+++    p+i+++   +++ + + +  Ga  
  Tp57577_TGAC_v2_mRNA9555   9 CTIRDICNGLCY-QVITCCTISDARNYLFNQNFDIILIEANMPSNDTFDFVGQITSHF---PVIMMSHDPTPSSVMDSITQGACA 89 
                               56899999999*.9999***************************************88...************************ PP

                               EEESS--HHH CS
              Response_reg  97 flsKpfdpee 106
                               f sKp ++++
  Tp57577_TGAC_v2_mRNA9555  90 FWSKPLEENQ 99 
                               *****99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.28E-171114IPR011006CheY-like superfamily
PROSITE profilePS5011021.1971108IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.93E-91112No hitNo description
PfamPF000721.7E-86100IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23009.5E-1710122No hitNo description
Gene3DG3DSA:1.10.10.608.6E-7144170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
VDHDIGALCT IRDICNGLCY QVITCCTISD ARNYLFNQNF DIILIEANMP SNDTFDFVGQ  60
ITSHFPVIMM SHDPTPSSVM DSITQGACAF WSKPLEENQF KIMWQHLVRK ALSETPELPQ  120
TLEVKGGKKR GREDVDLPKQ PLPKKSRLSW TPDLDKQFLT AVNQLGKYRK YLKGEIKKSK  180
FSRLSAFQGH DEIPTQEQHS AFQGYDEIPT QEQHSAFQES EMAIASGTFR NKNALLC
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA9555
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013455021.13e-52two-component response regulator ARR14
TrEMBLA0A392MN787e-78A0A392MN78_9FABA; Two-component response regulator ARR2-like (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.16e-20response regulator 11