PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA9105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 494aa    MW: 53670.1 Da    PI: 4.6937
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA9105genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.7e-40133193262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk+ss
  Tp57577_TGAC_v2_mRNA9105 133 PDKILPCPRCHSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKSSS 193
                               7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-30130190IPR003851Zinc finger, Dof-type
PfamPF027013.6E-32135191IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901137191IPR003851Zinc finger, Dof-type
PROSITE patternPS013610139175IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MLEAKDPAIK LFGKTIPVPE ISSGSGDSTG APASSSGDAV DDGIAQNHAS SLNSSNTNMD  60
EEDREIDQDT MEEELSKCKK EKDETLAQSS QKKTDLDTAS RLVEESINPS TEEEQKSNEE  120
QAENAQDKTL KKPDKILPCP RCHSMDTKFC YYNNYNVNQP RHFCKNCQRY WTAGGAMRNV  180
PVGAGRRKNK SSSSHYRQIT IPDVIAVQNS QSDSPNGIHP PPLNCNGTVF TFGTGSPLCE  240
SIESALNIVD KGVNTCTNNG FIRPENLRIH VPYAGEENSN ESPDASTTPA EDATVNNSLE  300
QAMPNCQSFP PQVPYYPGAP WLLPWNPSQW SSQVQPPPAF FPQGFAMPVY PPPAYWGFTV  360
PGAWNNPWLA QPSSPSSAAV NSGPNSPTLG KHSREESTLK LNEAAGSDEG NNKEEKSLWV  420
PKTLRIDDLG EAEKSSILTT LGINNNKTDL IRGGGLFKAF ASKDDEKDGM QNSPVMQANP  480
AAMSRSINFH ETS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618507.10.0DOF-type zinc finger DNA-binding family protein
TrEMBLG7KKV40.0G7KKV4_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGGLYMA18G49520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-95cycling DOF factor 2