PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 193aa    MW: 21046.3 Da    PI: 6.1534
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8908genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.58.2e-5822117297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+y
  Tp57577_TGAC_v2_mRNA8908  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIY 106
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l+++re+egek
  Tp57577_TGAC_v2_mRNA8908 107 LQRFREIEGEK 117
                               *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-5418125IPR009072Histone-fold
SuperFamilySSF471136.57E-4124154IPR009072Histone-fold
PfamPF008085.3E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.4E-215573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.4E-217492No hitNo description
PRINTSPR006159.4E-2193111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MADSDNESGG APNAGNSELS PREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKIYLQRF REIEGEKTVA  120
ARDKDVAPSS SSSSVFDYGA PPQVGMIMHH QQQHQQHQGH VYGSGGFHQV PGGPGYPNAG  180
SNAGRPSDWQ TH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4819112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182900.0JQ918290.1 Medicago truncatula nuclear transcription factor Y subunit B17 (NF-YB17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617812.21e-122nuclear transcription factor Y protein
SwissprotO233103e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLI3TAX51e-123I3TAX5_MEDTR; Nuclear transcription factor Y subunit B17
STRINGGLYMA18G08620.19e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-75nuclear factor Y, subunit B3