PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Trihelix
Protein Properties Length: 292aa    MW: 34993.4 Da    PI: 7.2015
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8693genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.89.3e-2650132186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               +W+ qe+++ + +r+++++++ ++k++k+lWe +s+km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++py+++l
  Tp57577_TGAC_v2_mRNA8693  50 QWSIQETKEFLMIRSDLDQTFMETKRNKQLWEVISNKMKEKGYHRSAEQCKCKWKNLVTRYKGCETMELEA---MRQQFPYYNEL 131
                               7*******************************************************************985...56689*****9 PP

                  trihelix  86 e 86 
                               +
  Tp57577_TGAC_v2_mRNA8693 132 Q 132
                               8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.17E-2349114No hitNo description
PfamPF138372.2E-2150134No hitNo description
PROSITE profilePS500907.27151107IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGHHLHHHQ QQHHQQQQRQ QQQQQQHQQH AHNIIGTSSV NVDVTDRFPQ WSIQETKEFL  60
MIRSDLDQTF METKRNKQLW EVISNKMKEK GYHRSAEQCK CKWKNLVTRY KGCETMELEA  120
MRQQFPYYNE LQAIFSARMQ RMLWAEAEGG SKKKGMHVSS EDEEELGNEE SEGDHKGNIK  180
KKKKKGKMVI GGGNDSGSTS NNLKEILEEF MKQQMQMEAQ WMEAFEAREN ERRLKEMEWR  240
QTMEALENER IMMEQRWRER EEQRRVREEA RAEKRDALIT ILLDKLTRED M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1251130786DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514215.11e-146PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804504e-73TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A072U0821e-134A0A072U082_MEDTR; Trihelix transcription factor GT-3a, putative
STRINGGLYMA18G43190.21e-128(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-53Trihelix family protein