PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8622
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 168aa    MW: 18735.2 Da    PI: 6.6539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8622genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.5e-4461051100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+
  Tp57577_TGAC_v2_mRNA8622   6 PCASCKLLRRRCAKDCAFAPYFPSHEPQKFAIVHKVFGASNVSKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQN 90 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+ +la++++e
  Tp57577_TGAC_v2_mRNA8622  91 QVSELQMQLAVAQAE 105
                               **********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4455106IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CAFAPYFPSH EPQKFAIVHK VFGASNVSKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIQ MQNEQVIPTQ  120
EINQDQKSYF IQDELTQYLN YGSSSSNNNV IHDSLKRDNM YGHDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3023351e-123CU302335.1 Medicago truncatula chromosome 5 clone mth2-155g22, COMPLETE SEQUENCE.
GenBankCR9541981e-123CR954198.2 Medicago truncatula chromosome 5 clone mte1-67f21, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616690.11e-114lateral organ boundaries (LOB) domain protein
SwissprotQ8LBW38e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7K2881e-114G7K288_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGPOPTR_0010s19180.11e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-75LBD family protein