PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 116aa    MW: 12993.9 Da    PI: 8.1072
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8457genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.71.1e-4417114198
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll++++ ++reda++sl+yeAear++dPvyG+vg i+ lq+
  Tp57577_TGAC_v2_mRNA8457  17 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQAHQREDAVNSLAYEAEARIKDPVYGCVGAISILQR 101
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallk 98 
                               q+ +l++el++++
  Tp57577_TGAC_v2_mRNA8457 102 QVIRLQKELDATN 114
                               ********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0416116IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4417114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
IYNYKMASSS SCYSNSPCAA CKFLRRKCMP DCIFAPYFPP EEPQKFANVH KIFGASNVSK  60
LLNEVQAHQR EDAVNSLAYE AEARIKDPVY GCVGAISILQ RQVIRLQKEL DATNAD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448135.12e-73lateral organ boundaries (LOB) domain protein
SwissprotQ9FML47e-68LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A072TXJ12e-73A0A072TXJ1_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA16G07770.22e-71(Glycine max)
STRINGGLYMA19G12650.32e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-60LBD family protein