PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 281aa    MW: 31770.2 Da    PI: 4.6769
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6833genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.32.6e-38221221101
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++rrkC + C+lapyfp++++k+f n+hklFG+ ++++++k++p+e r+ +m +++y++++ra dPv G+++ +++lq+
  Tp57577_TGAC_v2_mRNA6833  22 ACAACKYQRRKCGPTCILAPYFPHDRQKQFLNAHKLFGVGKITNMIKNVPPELRDVTMGTIMYQSDMRAIDPVGGCYRALQQLQS 106
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkeel 101
                               q e  +ael+l+++++
  Tp57577_TGAC_v2_mRNA6833 107 QCEFFQAELDLTRQHI 122
                               ***********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.79221122IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-3522119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MNNNNNNNNN IVSRNGNGTT QACAACKYQR RKCGPTCILA PYFPHDRQKQ FLNAHKLFGV  60
GKITNMIKNV PPELRDVTMG TIMYQSDMRA IDPVGGCYRA LQQLQSQCEF FQAELDLTRQ  120
HIAICRASSQ SQQLAANSNH HHHHYNDMIM NNNGNDVNDA AAAMNILNQF NQQHFVEEQM  180
NINMLPQPQQ LQPQYVDDVD LNPNYVPLQQ EDLNTWVNSI PLSPLTLNDN KKEMEEEEGE  240
NEEIVGDDKE SDQKPVFDLI NEMNSLDTGS NNIDPGHQVC *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597599.21e-123LOB domain protein
TrEMBLG7IUH81e-123G7IUH8_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-43LOB domain-containing protein 22