PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 91aa    MW: 10498.9 Da    PI: 4.2808
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6624genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26023.51.5e-071633698
                    DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                              +FG ++v++ ++a + +er  +++sl +e+++r+    +Ga g++l++  +le +++e+++l+
  Tp57577_TGAC_v2_mRNA6624  1 MFGWTRVMNWITARNIQERVPLAESLQWEGQIRMTAEFRGARGMFLEVIAELEDARNEISALQ 63
                              7*********************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.9E-5163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MFGWTRVMNW ITARNIQERV PLAESLQWEG QIRMTAEFRG ARGMFLEVIA ELEDARNEIS  60
ALQVVIQEHD AKINQLHLDI FEVQDEQTAD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-