PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6179
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ZF-HD
Protein Properties Length: 294aa    MW: 32402.5 Da    PI: 6.5622
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6179genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.21.5e-31205260359
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                vrY+eClkNhAa++Gg+a+DGCgEfmps ge+gt++al+C+AC CHRnFHR+eve 
  Tp57577_TGAC_v2_mRNA6179 205 VVRYRECLKNHAAAMGGNATDGCGEFMPS-GEQGTIEALNCSACHCHRNFHRKEVEG 260
                               79**************************9.999*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.8E-28206258IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-30207258IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.155208257IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-22210261IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MELSSSQDGD IPIPIINNTD NNYGVSSNGH AQHHMLHHHH HHVHDHPPTL HHNHNHGNII  60
ISSSSTAAAV PVAVVPQNPS INGTTTTTTS MQAAVSGVEL DHDHSSYKKS SSSSVVRXXX  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
MQAAVSGVEL DHDHSSYKKS SSSSVVRYRE CLKNHAAAMG GNATDGCGEF MPSGEQGTIE  240
ALNCSACHCH RNFHRKEVEG DSTEEDSYYH HNHNXLQQAA PPPQHEEIHV TSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7678942e-37JF767894.1 Trifolium alexandrinum microsatellite TaSSR397 sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-29homeobox protein 31