PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA5818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 378aa    MW: 40444.5 Da    PI: 9.139
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA5818genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.6e-3882140361
                    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s
  Tp57577_TGAC_v2_mRNA5818  82 EAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRS 140
                               7789*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3065130IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3284139IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24585139IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MAFTSIQAAY LDAANWQQHE QQQNHLQHPG NSSSVSQQLF QTPPPAPPQT ESQPHGGATT  60
GGSIRPGSMT DKARTANMPM PEAALKCPRC ESTNTKFCYF NNYSLSQPRH FCKTCRRYWT  120
RGGALRNVPV GGGFRRNKRS GKSSNNGNST KSPASSDRQT GSASSTTSIT SNNNHSSADI  180
LGLTPQMSSL RFMTPLHHNF NNPNDYGGGD LGLNYGFSYM GGGGGGGDLG SALVGGNGNS  240
ILSSSALEQW RMPMPMPMPM PQQHHQFPFL ANLEGSNGNL YPFEGNVQNH EMITSGGYVR  300
PKVSSTSGIM TQLASVKMEE SINRGFLGIN TINNNSNQGS EQYWNSAVVI GGNSSAANWN  360
DHVSGFSSSS NTTSNQM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003604971.20.0Dof domain zinc finger protein
TrEMBLG7JUJ40.0G7JUJ4_MEDTR; Dof domain zinc finger protein
STRINGVIT_08s0007g00180.t016e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-39DNA binding with one finger 2.4