PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA4828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 756aa    MW: 82672.9 Da    PI: 6.0162
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA4828genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-162468147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              r rWT+eE++++++a k++G   W +I +++g ++t+ q++s+ qk+
  Tp57577_TGAC_v2_mRNA4828 24 RERWTEEEHDRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                              78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0371973IPR017930Myb domain
TIGRFAMsTIGR015573.5E-172271IPR006447Myb domain, plants
SMARTSM007175.9E-132371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-82464IPR009057Homeodomain-like
PfamPF002492.1E-132467IPR001005SANT/Myb domain
CDDcd001671.83E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MDAYSSGEEV LVKTRKPYTI TKQRERWTEE EHDRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALVKG AALGQALDID IPPPRPKRKP SNPYPRKTNV GTPTLHSGAK  120
YGKPLIAVAS SHGKQAMDFE KESPPEKHKD EERPTTGKEN NNENCSKVFT ILKEAPCSSV  180
SSAIQSSISN LVPQTNSCTL REFTPSVKEV ITRDETNKSF PATEIENQML EIDDGKQTHK  240
TDGTCKTSKL DNSCSPKSVQ VEKTDGLTSA LTIDEMQSNQ NYPRHVTVHV VDGNLGTSTQ  300
TPSQDMLIQD STFQPIGGIN GQRNLFTNSA ASNTSESQNN MARSSIHQSF PPCPPFAQHN  360
HDDYQSFLNM SSTFSSLLVS TLLQHPAAHA AASFAATFWP YANIESSADS PACSQGAFPS  420
RQIGSPPGVA AIAAATVAAA TAWWAAHGLL PLCAPLHTAF ACPPASATVV PSTNLSEAPP  480
KTKQGDITLQ NPPLQDQIFD PEDSEALIAQ HSAAKSPAVS LSESEESGDA KLNTSSKATI  540
NLDINRPISE NPDPNKMEGR KLVDRSSCGS NTTSSCEETD VLEKDDKEKE DSKAPEADHL  600
ATDPSSRRYR SISNLIDSWK EVSEEGRLAF RALFSREVLP QSFSPPHDLI DKDLQTDNMK  660
HNEQNVDDRD QLDSMKCSSN CDMVQQNLPF VQNNNEEDGL LTLGLGQGKL KTRRTGFKPY  720
KRCLVEAKEN RVGTACNQVE ETGPKRIRLE GGSST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA4828
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1504430.0AC150443.2 Medicago truncatula chromosome 7 clone mth2-71o19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494878.10.0protein LHY isoform X1
RefseqXP_004494879.10.0protein LHY isoform X1
RefseqXP_004494880.10.0protein LHY isoform X1
RefseqXP_027188030.10.0protein LHY isoform X1
TrEMBLA0A2K3NWB00.0A0A2K3NWB0_TRIPR; MYB transcription factor MYB 114
STRINGXP_004494878.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.39e-97MYB_related family protein