PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA4181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33188 Da    PI: 6.4502
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA4181genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.7e-1888141356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k+++++ eq+++Le+ Fe  +++  e++ +LA+ l+L+ rqV +WFqNrRa++k
  Tp57577_TGAC_v2_mRNA4181  88 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALNLQPRQVAIWFQNRRARWK 141
                               456899***********************************************9 PP

2HD-ZIP_I/II131.24.1e-4287177191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+L+lqprqva+WFqnrRAR+ktkqlEkdy++Lkr+yda+k +n++L+++++
  Tp57577_TGAC_v2_mRNA4181  87 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALNLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQYDAVKLDNDALQAQNQ 171
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               +L++e+
  Tp57577_TGAC_v2_mRNA4181 172 KLQAEI 177
                               ***987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-2081145IPR009057Homeodomain-like
PROSITE profilePS5007117.39483143IPR001356Homeobox domain
SMARTSM003894.6E-1886147IPR001356Homeobox domain
CDDcd000869.06E-1688144No hitNo description
PfamPF000461.7E-1588141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-1990150IPR009057Homeodomain-like
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PfamPF021831.7E-16143183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTGLDKAMHE MAFFQANFML QTPHHHDDHH QHHHPPPSLN SILPQDYHGG PSFLGKRSMS  60
FSSGIELGEE ANIAEEDLSD DGSQAGEKKR RLNMEQVKTL EKSFELGNKL EPERKMQLAR  120
ALNLQPRQVA IWFQNRRARW KTKQLEKDYD VLKRQYDAVK LDNDALQAQN QKLQAEILAL  180
KNREPTESIN LNKETEGSSS NRSENSSDIK LDISRTPASD SPLSTQHHTF FPPSSRPSGG  240
IAQLFQTTSR PELQCQKIDQ LVKEESLSNM FCGMDDQAGF WPWLEQQHFN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA4181
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613642.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-113ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLG7KB591e-179G7KB59_MEDTR; Homeobox leucine zipper ATHB-like protein
STRINGAES966001e-180(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-106HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]