PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 392aa    MW: 44333.3 Da    PI: 7.7889
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40592genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.42.1e-35138198262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                ++++++cprC+ ++tkfCyynny+++qPr+fCk+C+ryWt+GG+ rn+ vG+grrknk ss
  Tp57577_TGAC_v2_mRNA40592 138 PDQIVPCPRCKNMDTKFCYYNNYNVKQPRHFCKNCQRYWTAGGTTRNMLVGAGRRKNKLSS 198
                                7899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-26135195IPR003851Zinc finger, Dof-type
PfamPF027012.6E-28140195IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.413142196IPR003851Zinc finger, Dof-type
PROSITE patternPS013610144180IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MMINDSSMKL FGRTIFVTHN HIDVSTNDSS SEFDHHTHED LSDHSLHSSL SSSSPLEVNS  60
QTQHDAKRYK ETKSKKLTSV QDDDEVSQQT TEDLKTPTSS SLIENQKTPS SEAETSQLNS  120
TKLDEQSDMS QDKSLKKPDQ IVPCPRCKNM DTKFCYYNNY NVKQPRHFCK NCQRYWTAGG  180
TTRNMLVGAG RRKNKLSSSF SSDVSRCRQM STVLTFGSDS STSLKKKMNV ESHEEKIDTN  240
SYQSFPPQFP WNPAMSYPVT FYPNIAYYGG CLVPSWSVQP ISPQSCAPTL GKHSRDGNIF  300
KGFTSKGDEN NHEVEVSSSV MKANPAALSR SHVFHERRSK CPWENIKKSS EISFYEDLFE  360
DSIPPKSPLI RLYFQLSSDT YVRPMVDPRL S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613827.11e-143DOF zinc finger protein
TrEMBLG7KGL91e-143G7KGL9_MEDTR; DOF zinc finger protein
STRINGGLYMA02G12081.19e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1731037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.12e-40Dof family protein