PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 370aa    MW: 40750.4 Da    PI: 7.2746
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40538genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof109.22e-34139195359
                     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                + +++cprC+s+ntkfCyynny+++qPr+fCk+C+ryWt+GG+ r + +G+grrknk
  Tp57577_TGAC_v2_mRNA40538 139 DIIVPCPRCKSMNTKFCYYNNYNVKQPRHFCKNCQRYWTAGGTTRSMLIGAGRRKNK 195
                                56789***************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-25123195IPR003851Zinc finger, Dof-type
PfamPF027018.8E-29142195IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.273142196IPR003851Zinc finger, Dof-type
PROSITE patternPS013610144180IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MMIIDSTRKL FGRTIFLTHN NIDVSTDDSS SELASRLPNE DLSDHSLHSS LSSTSPLEVN  60
SPTEHVAKRY KETSIKELTS MQDDEASFQT TEDSKSPTSS SLVENPKTPL SETETSELNS  120
SKIDEQSDMS QDKSPNKPDI IVPCPRCKSM NTKFCYYNNY NVKQPRHFCK NCQRYWTAGG  180
TTRSMLIGAG RRKNKITFPS DVSHNGQMST TVLAFGSDSP MNVGSHEGTS DKSSQSVFPP  240
QFPWNPTMFY PVAFYPNIAY YGGCLPPSWS VQSISPQSCA PSNPSLGKHS RDGEIIFHSN  300
SKKGKLGSEN NKIESNNNSV LIPKILRTGL FKGFASKGDE ESYVVEASSS ILQANPAALS  360
RSLVFHERI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613833.11e-156cycling DOF factor 2
TrEMBLG7KGM51e-156G7KGM5_MEDTR; Cycling DOF factor 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1731037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-46cycling DOF factor 1