PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA40403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SBP
Protein Properties Length: 258aa    MW: 28194.3 Da    PI: 8.4291
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA40403genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.62.7e-4191168178
                                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                +Cqv+gC++ l +akeyhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Tp57577_TGAC_v2_mRNA40403  91 RCQVDGCHVALMNAKEYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSQ 168
                                6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.3E-3488153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.13789166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-3890171IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3292165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MDFGGNMFCL NNRDQSNNNN GNSNGFTTWG STSNGTPATA WNMDIFHVPV ENTADVNGGG  60
GGGGGLGDKR GKGYCGGGGG KVAAASFAVA RCQVDGCHVA LMNAKEYHRR HKVCEMHSKA  120
PKVVVLGLEQ RFCQQCSRFH VVSEFDDSKR SCRRRLAGHN ERRRKSSQDS VARNSSQGGC  180
ALSLLSSRTD SWLSPADLSV RCSAALSELI AENRAAIMAR QYVSDRDWHL HHHAVEDYRE  240
IQPESNYFPQ QMFPQTH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31921651184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA40403
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1517436e-84AC151743.28 Medicago truncatula clone mth2-25e15, complete sequence.
GenBankAC1519156e-84AC151915.8 Medicago truncatula clone mth2-30n12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513942.11e-128squamosa promoter-binding-like protein 7
SwissprotQ01JD12e-54SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT422e-54SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A1S2Z2N01e-127A0A1S2Z2N0_CICAR; squamosa promoter-binding-like protein 7
STRINGXP_004513942.11e-127(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-36squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]