PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SBP
Protein Properties Length: 414aa    MW: 46887.1 Da    PI: 6.5097
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39779genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.2e-41174250177
                                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                +Cqv gC++dls+ k+yh+rh+vC+vhsk+++v+v+g+eqrfCqqCsrfh + efD++krsCrrrLa+hnerrrk+q
  Tp57577_TGAC_v2_mRNA39779 174 VCQVYGCNMDLSSSKDYHKRHRVCDVHSKTAKVIVNGIEQRFCQQCSRFHLVAEFDDGKRSCRRRLAGHNERRRKPQ 250
                                6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-34169236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.616172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-39173254IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MESWSYIPEE RSYLFSDEMD FSLDAFMRSR KPLVEWENKS SCNFERDGFK GMEFVDLGFP  60
DFLQKSFHSS KPMETSSCEL DSNNSSKRVN SSSHVIAFDS SFGEEDSEPK HLSSSLVELK  120
NRDSSSIDLK LGRLADFQGA NIDRNAKEFT SAAMPQTSLA KRARTSSLPA QAPVCQVYGC  180
NMDLSSSKDY HKRHRVCDVH SKTAKVIVNG IEQRFCQQCS RFHLVAEFDD GKRSCRRRLA  240
GHNERRRKPQ FDYMTSKQHK ILQSYQGTTN FSFQDIFIKL EEEPICSPQL EPSATLGHEL  300
STRALSLLSA QSQNPSRHAA GNALPTSRTF RDVHTQDRDD QVSETLLMIS SVDKHEQNES  360
FPSGINSKEV IKSENGGSTV DLFQLSSHLQ RVEQQRNSVL VKWEDEDCSF PTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-29166248284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA39779
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9329681e-120CR932968.2 Medicago truncatula chromosome 5 clone mth2-8e17, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024640056.10.0squamosa promoter-binding-like protein 6 isoform X2
SwissprotQ94JW86e-65SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLA0A2K3PCY20.0A0A2K3PCY2_TRIPR; Squamosa promoter-binding-like protein 6-like
STRINGAES971840.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-67SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]