PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 214aa    MW: 24087.2 Da    PI: 8.2021
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39704genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.92e-39451441100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+l+r+C ++C++apyf a++ kkfa vhk+FGasnv+k+l ++pee+re++++sl+yeA+ar+rdPvyG++g i  lq
  Tp57577_TGAC_v2_mRNA39704  45 SCAACKFLKRRCIPNCIFAPYFRADECKKFAKVHKVFGASNVSKILIEVPEEQREETVNSLAYEADARLRDPVYGCIGAIALLQ 128
                                6*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                +++ +l+++la +k++
  Tp57577_TGAC_v2_mRNA39704 129 RKMIELQHDLAIAKDR 144
                                **********999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3444145IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3845142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
LPLNSINSPK YTNRENHIFI TTKTKDREQY RNIIMKGYEP RSSSSCAACK FLKRRCIPNC  60
IFAPYFRADE CKKFAKVHKV FGASNVSKIL IEVPEEQREE TVNSLAYEAD ARLRDPVYGC  120
IGAIALLQRK MIELQHDLAI AKDRLARCAA AAAATHSSSS FSNDMSNSNV SLPPFPEFYS  180
CSDFNDNFSH SSSSQLFSRN ETGDDFLQIP YIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447290.0AC144729.29 Medicago truncatula clone mth2-15j6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616672.11e-108lateral organ boundaries (LOB) domain protein
SwissprotQ9SRL86e-63LBD21_ARATH; LOB domain-containing protein 21
TrEMBLG7K2701e-108G7K270_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA11G35500.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.14e-60LOB domain-containing protein 21