PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 360aa    MW: 41207.3 Da    PI: 6.7078
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39687genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.14.6e-36101091100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaCk++rrkC+++C lapyfpa+qpk f nvhklFG+sn++k+lk l++++++ am+s++ +A+ r + Pv+G+ + i +lq
  Tp57577_TGAC_v2_mRNA39687  10 ACAACKFQRRKCTPECLLAPYFPADQPKIFLNVHKLFGVSNIVKILKYLEPSQKKVAMDSIIIQANYRDKYPVHGCWEEICRLQ 93 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 q+  +++el+++ ++
  Tp57577_TGAC_v2_mRNA39687  94 YQIWLMEEELHVVYQQ 109
                                **********999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8129110IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKFQRRK CTPECLLAPY FPADQPKIFL NVHKLFGVSN IVKILKYLEP  60
SQKKVAMDSI IIQANYRDKY PVHGCWEEIC RLQYQIWLME EELHVVYQQL EICRQQQQQQ  120
LPHDDVTSQL ELGMAPRSSN ALALFNQTPQ PQSYNINNNN TVAAPLSVSQ QHSYSNSNSV  180
DYNNSPLYMD SKDNATNPNL WIQCPYTSNN SNSITMQPHQ LIASESQPLS SVQQGVVEDN  240
YDEMHSFFDT VDDRQSYIYS KEAYESSSEE SLKDTRKCTE HVSENELKSA AACFSLTSLS  300
VYPITSHPSR HYYKIQHNKG VIHTMHLMSK HNQNNVDGKY MLAESCHEYH FLIFKPKLQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457865.10.0LOB domain protein
TrEMBLA0A072URD20.0A0A072URD2_MEDTR; LOB domain protein
STRINGPGSC0003DMT4000342884e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-46LOB domain-containing protein 27