PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 712aa    MW: 77113.8 Da    PI: 6.0509
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39153genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16421458340
                        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                +k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  Tp57577_TGAC_v2_mRNA39153 421 CKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQECFNKP 458
                                89**********************************96 PP

2TCR50.63.9e-16505543139
                        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Tp57577_TGAC_v2_mRNA39153 505 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 543
                                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.0E-17419460IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.953420545IPR005172CRC domain
PfamPF036381.4E-11422457IPR005172CRC domain
SMARTSM011142.9E-17505546IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11507543IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MVTXXXXXXX XXXXXXXXXX XXXXNKVYSN EGALADSTLS QHNSCELHDS AGQGISVGDA  60
TIELSNEQAK FSDELPQALQ YNCGSPGYDP RLCGDAANSL LELSGEAVSD VAYVRDSGKT  120
DSVEAELHLQ GTSQIDPKGE GSDCDWDGLI HNASADVLID AEAFKGLAFK GLMHGSSIRL  180
SDFVPLLQQS TSNNDQKTHL VDSVASGSEH EIHNHCSELV SVTDIDPTQD NLANGSLMTS  240
NPNEKMDNEL VSVTHRGIRR RCLDFEMASV RKKISDDNSN IGSSTTQSEV RNAANEKQLL  300
PAKRNANSQR SILRGIGLHL NALATVKDHK GKQNENVTSG DQVGLASSTS LLLSACQEHQ  360
RLSILSVSVS SERETDPSDN GVQPSEDCPQ ALAYMAADDF NQNSPKKKRR KSEPVGETEG  420
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CQECFNKPIH EDTVLQTRKQ IESRNPLAFA  480
PKVIRSADSV PEVGIDPNKT PASARHKRGC NCKKSSCLKK YCECYQGGVG CSINCRCEGC  540
KNAFGRKDGS ASIGIEGETE EETETSDKGV DEKAIQKTEI QNIEDHPESS LVSTPLQLSR  600
PLLPMPFSSK GKPPRSFVTT ITGSGYFASQ KHAMPNSLWS QSKPFQTIPD DEMPEILRGD  660
SSPIACIKTS SPNGKRISSP NCEMGSSPAR RGGRKLILQS IPSFPSLTPH P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1742254212120Protein lin-54 homolog
5fd3_B5e-1742254212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405409KKKRR
2405410KKKRRK
3406410KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA39153
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610744.20.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF51e-129TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
SwissprotQ9LUI31e-129TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A2Z6LLQ60.0A0A2Z6LLQ6_TRISU; Uncharacterized protein
STRINGXP_004511373.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-127TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  3. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  4. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]