PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 813aa    MW: 89272 Da    PI: 6.4298
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39106genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.67e-21127182156
                                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Tp57577_TGAC_v2_mRNA39106 127 KKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 182
                                688999***********************************************999 PP

2START198.14e-623255512206
                                HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
                      START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWde 74 
                                la+ a++elvk+a+ +ep+W +s+    e++n +e+++++++s         + +ea+r+sgvv+ ++  lve+l+d++ +W+e
  Tp57577_TGAC_v2_mRNA39106 325 LALVAMDELVKMAQTNEPLWIRSVeggrEILNHEEYTRTISTSSCiglkpngFVSEASRESGVVIINSLALVETLMDSN-RWSE 407
                                67889***********************************99888**********************************.**** PP

                                T-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-E CS
                      START  75 tla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRae 146
                                +++    + +t evissg      galqlm+aelq+lsplvp R + f+R+++q+ +g+w++vdvS+d  ++ +   s +  ++
  Tp57577_TGAC_v2_mRNA39106 408 MFPcviaRTSTNEVISSGingtrnGALQLMQAELQVLSPLVPvRLVNFLRFCKQHAEGVWAVVDVSIDTITQTSAvASTFLNCR 491
                                *********************************************************************9999999******** PP

                                ESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                      START 147 llpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                +lpSg+l+++++ng+skvtwveh++++++++h+l+r+l++ g+ +ga++wvatlqrqce+
  Tp57577_TGAC_v2_mRNA39106 492 KLPSGFLVQDMPNGYSKVTWVEHTEYEESQVHQLYRPLLSLGMGFGAQRWVATLQRQCEC 551
                                **********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-20117184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-22119184IPR009057Homeodomain-like
PROSITE profilePS5007117.297124184IPR001356Homeobox domain
SMARTSM003899.5E-18125188IPR001356Homeobox domain
CDDcd000862.13E-18126184No hitNo description
PfamPF000462.1E-18127182IPR001356Homeobox domain
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PROSITE profilePS5084842.613315554IPR002913START domain
SuperFamilySSF559615.93E-32317551No hitNo description
CDDcd088751.78E-118319550No hitNo description
SMARTSM002341.3E-46324551IPR002913START domain
PfamPF018526.2E-54325551IPR002913START domain
SuperFamilySSF559615.93E-23579805No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MSFGDNKSGC GESAKISSVS DIAFSNGTNH NNNYRIIMPS SAISQPHLST PTLVKSMFNS  60
PGLSLSLQTN MEGQGGGGDM SRLMAESFHG LRRNREEEEE EHESRSGGSD NIDGVSGDDA  120
ADNPPRKKRY HRHTPQQIQE LESMFKECPH PDEKQRLELS KRLCLETRQV KFWFQNRRTQ  180
MKTQLERHEN SLLRQANDKL RVENMSIREA MRNPMCSNCG GPTIINEISL EEQHLRIENA  240
RLKDDLERVC TLASKFLGRP ITSLPNSSLE FSFVGDHSNT LPSTLPLGQD FGMVSISPPS  300
TIIATNSTSS NGFDRSIERS MLLELALVAM DELVKMAQTN EPLWIRSVEG GREILNHEEY  360
TRTISTSSCI GLKPNGFVSE ASRESGVVII NSLALVETLM DSNRWSEMFP CVIARTSTNE  420
VISSGINGTR NGALQLMQAE LQVLSPLVPV RLVNFLRFCK QHAEGVWAVV DVSIDTITQT  480
SAVASTFLNC RKLPSGFLVQ DMPNGYSKVT WVEHTEYEES QVHQLYRPLL SLGMGFGAQR  540
WVATLQRQCE CLAILMSSAL PSREQSAISS GGRRSMLKLA QRMTNNFCAG VCASTVHKWN  600
KLNAGNVGED VRVMTRKSVD DPGEPSGVVL SAATSVWLPA SQQKVFNFLR NERLRSEWDI  660
LSNGGPMQEM AHIAKGHDHG NCVSLLRASG NNSSQSSMLI LQETCTDASG SLVVYAPVDI  720
PAMHVVMNGG DSAYVALLPS GFAILPDGYS DDSDNQRGGL QHRANGSLLT VAFQILVNSL  780
PTAKLTVESV ETVNNLISCT VQKIKAALQC ES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA39106
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1487640.0AC148764.16 Medicago truncatula clone mth2-30o12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623826.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2Z6N8C00.0A0A2Z6N8C0_TRISU; Uncharacterized protein
STRINGAES800440.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]