PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA38873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 310aa    MW: 34822.7 Da    PI: 5.4653
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA38873genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.84.3e-39151141100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++  +++am+++++++++ra+dPv G+++ i++lq
  Tp57577_TGAC_v2_mRNA38873  15 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNISKIIKNLDPPLKDQAMRTIIFQSDMRANDPVGGCYKYIQDLQ 98 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 q+e  k el+l+ ++
  Tp57577_TGAC_v2_mRNA38873  99 TQIEYCKIELDLVLQQ 114
                                *********9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.49114115IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3615110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MNNVNINKNN NTTQACAACK YQRRKCAPDC ILAPYFPHDR QRQFLNAHKL FGVSNISKII  60
KNLDPPLKDQ AMRTIIFQSD MRANDPVGGC YKYIQDLQTQ IEYCKIELDL VLQQLAVFRA  120
QSHQHQQQEV VNYGDQVLMN SDSLLGFYNS SGSIVSTTAP AHYHYNVQQQ VVPQLQLQEH  180
EQEQYIMMNE SNSSNSSINS NTPLQQHIND WGAMQSSISL SSLSLHGQSS NASDEYDHKP  240
IIDIPCDERN ELGFDSGEIL HHSDEAVLFK INDGVIKAEG DYIQQTQAQA QDHDLKGAAT  300
LFTLTNCTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1409150.0AC140915.6 Medicago truncatula chromosome 8 clone mth2-10l24 map 9.500cM, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627098.11e-164LOB domain protein
TrEMBLG7LHF81e-164G7LHF8_MEDTR; LOB domain protein
STRINGGLYMA07G01170.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-61LOB domain-containing protein 22