PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA38750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 197aa    MW: 21047.7 Da    PI: 5.7681
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA38750genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.37.3e-4513111199
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq
  Tp57577_TGAC_v2_mRNA38750  13 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPQQREDAVNSLAYEAEARVRDPVYGCVGAISFLQ 96 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallke 99 
                                +q+++l++el+++++
  Tp57577_TGAC_v2_mRNA38750  97 KQVQKLQKELDAANT 111
                                **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.79612113IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4413110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MASSSSSSSY NSPCAACKFL RRKCMPGCIF APYFPPEEPQ KFANVHKIFG ASNVTKLLNE  60
LLPQQREDAV NSLAYEAEAR VRDPVYGCVG AISFLQKQVQ KLQKELDAAN TDLLRYSLTD  120
HIPAAPTSLS MPPGVVSVQQ MPQRSQLSAR DEGGGFFGQS PNIANYSFPY SLPWTDTSSE  180
DMSEGGGGGG GGGNLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579581.11e-106PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_006579580.11e-106PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_003525551.21e-106PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_006579579.11e-106PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML44e-77LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0B2RRB01e-106A0A0B2RRB0_GLYSO; Protein LATERAL ORGAN BOUNDARIES
TrEMBLK7KMS91e-106K7KMS9_SOYBN; Uncharacterized protein
STRINGGLYMA05G02530.21e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-66LBD family protein