PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA38548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 220aa    MW: 25365.8 Da    PI: 6.1712
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA38548genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.47.9e-5745140297
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                +eqdrflPianv+rimkkv+Pan+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyveplk 
  Tp57577_TGAC_v2_mRNA38548  45 KEQDRFLPIANVGRIMKKVIPANGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVEPLKS 128
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyrelegek 97 
                                yl+kyr++egek
  Tp57577_TGAC_v2_mRNA38548 129 YLQKYRDIEGEK 140
                                *********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.0E-5440166IPR009072Histone-fold
SuperFamilySSF471135.28E-4147164IPR009072Histone-fold
PfamPF008081.0E-2750114IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-217896No hitNo description
PROSITE patternPS0068508197IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-2197115No hitNo description
PRINTSPR006154.2E-21116134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDDETHTTLP NGFSTETPEN HCLKTNTTTT TNNNNLNHHH NNSNKEQDRF LPIANVGRIM  60
KKVIPANGKI SKDAKETVQE CVSEFISFVT GEASDKCQRE KRKTINGDDI IWAITTLGFE  120
DYVEPLKSYL QKYRDIEGEK VNVPKQQRSE QRLHQDQHHN QDEFNNQHFN TSVYTSTNLM  180
SQPPYVTNDQ QYPLPFSSNS IQKQLRPQDQ IDSIGHWYE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-4543135294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-4543135294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182880.0JQ918288.1 Medicago truncatula nuclear transcription factor Y subunit B15 (NF-YB15) mRNA, complete cds.
GenBankAC1523490.0AC152349.12 Medicago truncatula clone mth2-52p10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630291.11e-123nuclear transcription factor Y protein
SwissprotQ9SIT94e-69NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLG7LE451e-123G7LE45_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA05G32680.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.14e-70nuclear factor Y, subunit B7