PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA38183
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 619aa    MW: 68589 Da    PI: 6.8234
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA38183genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.8e-28193246155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                kpr++W+ eLH++Fv+av+qL G +kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Tp57577_TGAC_v2_mRNA38183 193 KPRVVWSVELHQQFVSAVNQL-GLDKAVPKKILELMNVPGLTRENVASHLQKFRL 246
                                79*******************.********************************8 PP

2Response_reg71.92.7e-24171251109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl+vdD+ + +++++++  + +y +v++++++++al++l+e++  +D++l D+ mp+mdG++ll++   e  +lp+i+++  + 
  Tp57577_TGAC_v2_mRNA38183  17 VLVVDDDVTTLKIIERMSVRCHY-RVTTCSEATAALKILRERKgcFDVVLSDVHMPDMDGYKLLEHVGLEM-DLPVIMMSVDDR 98 
                                89*********************.*******************************************6644.8*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 +++ + ++ Ga d++ Kp+  eel++
  Tp57577_TGAC_v2_mRNA38183  99 TSTVMKGIRHGACDYFIKPVRLEELRN 125
                                *************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.5E-1491615IPR017053Response regulator B-type, plant
SuperFamilySSF521721.57E-3214137IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.9E-4014148No hitNo description
SMARTSM004481.6E-2815127IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.9716131IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-2017126IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.67E-2518131No hitNo description
PROSITE profilePS5129410.81190249IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-30190251IPR009057Homeodomain-like
SuperFamilySSF466891.02E-19190250IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-24193246IPR006447Myb domain, plants
PfamPF002491.2E-7195244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MEQSSMNSGE FPAGLRVLVV DDDVTTLKII ERMSVRCHYR VTTCSEATAA LKILRERKGC  60
FDVVLSDVHM PDMDGYKLLE HVGLEMDLPV IMMSVDDRTS TVMKGIRHGA CDYFIKPVRL  120
EELRNIWQHV ARKFLNESKE HDNSSSREDN DRNNISSAAG ATKGIVKEQK KRSNLKDEED  180
VELENDDPST SKKPRVVWSV ELHQQFVSAV NQLGLDKAVP KKILELMNVP GLTRENVASH  240
LQKFRLYLKR LSGVAQQQNE MLNTVPGTIE SKLAAAERYI QTVAASGYVS PETLAALHAE  300
LLGHPVTNIV PTVDRTTLMQ AFEQEPKHSG ADDHDVASGQ PLAKYPSNIV NNFPQSILKV  360
DNSSLGYGAW PPSDTLGSVS RGSLGVPNNN MVIDILQHHQ KHQHQQKQQK SPIHDQNQSI  420
NVQPSCLVVP AQSSDTFQEV KSVASVNKDC SFSRNAIIDY SQQSQKSNIS SSTSQYLGRD  480
TKSTSISPLM SSFSVGSSNS NIQQIQNSTS TFGAARPLPS LLPMTFRQVP YDIKSSDSLD  540
QVCLRNPRFV GKGNHISSFE NEIESSASDF SHMKVFVACN GNTVKEEPKE EPNFIRYSNV  600
NHPVLYNYPS HDHSSAST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-21189252164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA38183
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150432e-55AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498241.10.0two-component response regulator ORR21
RefseqXP_004498242.10.0two-component response regulator ORR21
SwissprotA2XE311e-130ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLA0A2K3MNL10.0A0A2K3MNL1_TRIPR; Two-component response regulator
STRINGXP_004498241.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118082433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-99response regulator 2