PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA38087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 169aa    MW: 18361.5 Da    PI: 6.9463
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA38087genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.81.2e-5625118295
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                reqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+
  Tp57577_TGAC_v2_mRNA38087  25 REQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKI 108
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyreleg 95 
                                yl++yre ++
  Tp57577_TGAC_v2_mRNA38087 109 YLTRYREGDT 118
                                ******9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5421139IPR009072Histone-fold
SuperFamilySSF471133.29E-4027144IPR009072Histone-fold
PfamPF008081.9E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-207795No hitNo description
PRINTSPR006151.4E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSEAPASPGG GSHESGEHSP RSNIREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKIYL TRYREGDTKG  120
SAKGDTSAKK DVQQGSNPQL AHQGSFSQGV SYANAQGQHM MVPMQGPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4824115192Transcription factor HapC (Eurofung)
4g92_B4e-4824115192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0000831e-178KJ000083.1 Medicago sativa nuclear factor Y subunit B isoform 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625575.11e-118nuclear transcription factor Y subunit B
SwissprotQ8VYK44e-82NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0H3UW931e-118A0A0H3UW93_MEDSA; Nuclear factor Y subunit B isoform 3
TrEMBLG7L1Q21e-118G7L1Q2_MEDTR; Nuclear transcription factor Y subunit B
STRINGGLYMA03G33490.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.14e-79nuclear factor Y, subunit B10