PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA37871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GRAS
Protein Properties Length: 567aa    MW: 62655.5 Da    PI: 5.9095
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA37871genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS256.11.3e-781725512374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                +elL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++s+s++ +   + +++  +     ++l  f+
  Tp57577_TGAC_v2_mRNA37871 172 EELLNPCAAAITGGNLNRVQHLLYVLHELASTTGDANHRLAAHGLRALTHHLSSSSSSTTSGTITFAST--EPRFFQKSLLKFY 253
                                6899**************************************************666666555444444..34555556666** PP

                       GRAS  86 evsPilkfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..........s 154
                                evsP++ f + +aN  Il+ +++e    + +Hi+D+++s+G+QWp++l+aL+ Rp ++pp +R+T+v +++++           
  Tp57577_TGAC_v2_mRNA37871 254 EVSPWFSFPNNIANASILQVLAEEpnssRSLHILDIGVSHGVQWPTFLEALSRRPgGPPPLVRLTVVTASSTEndqnmetpfsV 337
                                *********************9998888999************************55566*******99887777766655544 PP

                       GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkv 238
                                     +  +rL  +A++++v++++n l  + l++l+ ++ +++p+E+l+V+ +++lh+l    ++ ++er+e+Lk++++++Pk 
  Tp57577_TGAC_v2_mRNA37871 338 GPCGDNFSSRLLGYAQSINVNLQINKLDNHPLQTLNAQSVDTSPDETLIVCAQFRLHHLN---HNAPDERREFLKVLRDMEPKG 418
                                445578899*****************9999*****************************8...77777789************* PP

                       GRAS 239 vvvveqeadh...nsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                                v+++e+++++   + ++F+++f++ +ey + ++ds+ +a  +res+er+++E e     + ++++++ ++    +e +ekW er
  Tp57577_TGAC_v2_mRNA37871 419 VILSENNMECccsSCGDFATGFSRRVEYLWRFLDSTsSAFKGRESDERRMMEGE-----AAKALTNQREM----NEGKEKWCER 493
                                *******9886334459*******************555545555666666555.....77777776666....99******** PP

                       GRAS 319 leeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                                ++eaGF    ++e+a +  ++llrk++ +++++veee+ + v l Wk++p+ ++S W+
  Tp57577_TGAC_v2_mRNA37871 494 MKEAGFAGEVFGEDAIDGGRALLRKYDnNWEMKVEEENSTTVgLWWKGQPVSFCSLWK 551
                                ***************************9999******999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.787145529IPR005202Transcription factor GRAS
PfamPF035144.5E-76172551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MTMEPNPTSD HILDWLEGSV SFFPSFLDDP YNNGYIQEYP LWDQNQDIHN QYQIDVNTNS  60
PNGTNSTNNI VAASTTTTTT STTSLEPISS NNIPFSDLPK KRNAEDEPGL KKQSQNQKNK  120
RIKSRPTNEA DNGDAAIEGT VVRKPGGNKK GAGKASGNNS GNGNNKDGRW AEELLNPCAA  180
AITGGNLNRV QHLLYVLHEL ASTTGDANHR LAAHGLRALT HHLSSSSSST TSGTITFAST  240
EPRFFQKSLL KFYEVSPWFS FPNNIANASI LQVLAEEPNS SRSLHILDIG VSHGVQWPTF  300
LEALSRRPGG PPPLVRLTVV TASSTENDQN METPFSVGPC GDNFSSRLLG YAQSINVNLQ  360
INKLDNHPLQ TLNAQSVDTS PDETLIVCAQ FRLHHLNHNA PDERREFLKV LRDMEPKGVI  420
LSENNMECCC SSCGDFATGF SRRVEYLWRF LDSTSSAFKG RESDERRMME GEAAKALTNQ  480
REMNEGKEKW CERMKEAGFA GEVFGEDAID GGRALLRKYD NNWEMKVEEE NSTTVGLWWK  540
GQPVSFCSLW KLDKQNSSSS TLTAKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-211725516375GRAS family transcription factor containing p
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2296920.0AC229692.10 Medicago truncatula clone mth2-60b17, complete sequence.
GenBankAJ9724730.0AJ972473.1 Medicago truncatula partial NSP1 gene for Nodulation Signaling Pathway 1 protein.
GenBankAJ9724780.0AJ972478.1 Medicago truncatula NSP1 gene for Nodulation Signaling Pathway 1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627294.20.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLG7L7I40.0G7L7I4_MEDTR; GRAS family transcription factor
STRINGGLYMA16G01020.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-152GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]