PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA37093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 672aa    MW: 73951.5 Da    PI: 6.2944
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA37093genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like796e-25214267155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                kpr++W+ +LH++F+ av+qL G ekA+Pk+il+lm+ + Lt+e+v+SHLQk+Rl
  Tp57577_TGAC_v2_mRNA37093 214 KPRVVWSVDLHKKFLIAVNQL-GLEKAVPKKILDLMNDERLTRENVASHLQKFRL 267
                                79*******************.********************************8 PP

2Response_reg80.17.3e-27291371109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl vdD+p+ +++l ++l++ +y +v++++++ eal++l+e++  +Dl++ D++mp+mdG++ll+    e ++lp+i++++h +
  Tp57577_TGAC_v2_mRNA37093  29 VLAVDDNPTCLKVLDKLLRQCEY-HVTTTTNAIEALRMLRENRnnFDLVISDVDMPDMDGFKLLEMVGLE-MDLPVIMLSGHRD 110
                                799********************.***************999889*******************998554.48*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 +++ + ++ Ga d+l Kp+  eel +
  Tp57577_TGAC_v2_mRNA37093 111 RNMVFKGISHGACDYLLKPVRLEELQN 137
                                ************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.0E-1492650IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.4E-4326175No hitNo description
SuperFamilySSF521728.4E-3726151IPR011006CheY-like superfamily
SMARTSM004487.4E-3327139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.81728143IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.8E-2429137IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.84E-2930142No hitNo description
Gene3DG3DSA:1.10.10.602.4E-26211271IPR009057Homeodomain-like
SuperFamilySSF466892.87E-17212271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22214267IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MAVENQKDHL RDEEEDGFIN RFPIVGMRVL AVDDNPTCLK VLDKLLRQCE YHVTTTTNAI  60
EALRMLRENR NNFDLVISDV DMPDMDGFKL LEMVGLEMDL PVIMLSGHRD RNMVFKGISH  120
GACDYLLKPV RLEELQNIWQ HVVRKQTTAS KDQNKASNED RNPNISGGNS QNVLENIAEQ  180
NKNLGKRRKD QAEEEENEDG EGTGDEDDPS SQKKPRVVWS VDLHKKFLIA VNQLGLEKAV  240
PKKILDLMND ERLTRENVAS HLQKFRLYLK KANHHQGNMV AALGGGNDSY FQMNGMEGYA  300
NFCTSTGSGT ISSTGMPSCP SSAVFGRLNS PAGLNMRGMS SSTLVQPVPS QNINNSWIPA  360
NQSSSLLHGI PTQLNQSKLN NCATGISQLT QIDSTGFAVP SGFHNSRATL SNANNSLQVS  420
NHHLMMDGNS QQTHNSGSFR NQSSVGSASL GNTNAGIGGF SNLLDYNHCN ENWQSQAQLP  480
KFPANSLPVC ESFNGNQLHP TSITAFNPRP CVGNNQVDFS SGNVITATLE DARNVPSFQE  540
GGLIGNVIQP TSYAVQQRWE EHKVDYSQNM IRPFNPINLQ VSSSREATNF VVHNTNQSKT  600
VCNNRVDASF VDQVNGTSTS VGHCTEVEKL SSDLRVNSND AYMREIMASQ VGYIPGFGTI  660
NDIMGTMVKR V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-24210273164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA37093
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013463823.10.0two-component response regulator ARR12
SwissprotQ6K8X61e-114ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2K3N0Q00.0A0A2K3N0Q0_TRIPR; Two-component response regulator
STRINGGLYMA15G24770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-111response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]