PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA37040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 545aa    MW: 62077.6 Da    PI: 5.9111
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA37040genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.61.4e-23209262155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k+r+ W+ +LH++Fv+av+++ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Tp57577_TGAC_v2_mRNA37040 209 KARVIWSVDLHQKFVKAVNRI-GFDKIGPKKILDLMNVPWLTRENVASHLQKYRL 262
                                68*******************.********************************8 PP

2Response_reg79.11.6e-26311391109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl+vdD+p+ +++l+++l+k  y +v+++  + eal++l+ek+  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge
  Tp57577_TGAC_v2_mRNA37040  31 VLVVDDDPTWLRILEKMLKKCFY-QVTTCCLAIEALKKLREKKdaYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGE 112
                                89*********************.***************988889**********************6644.8*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 + + + ++ Ga d+l Kp+ ++el++
  Tp57577_TGAC_v2_mRNA37040 113 TSRVMKGVQHGACDYLLKPIRMKELRN 139
                                ************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.6E-4328158No hitNo description
SuperFamilySSF521726.69E-3628161IPR011006CheY-like superfamily
SMARTSM004487.3E-3229141IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.58630145IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.8E-2431140IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.57E-3032145No hitNo description
SuperFamilySSF466896.99E-17207266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-27208267IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-20209262IPR006447Myb domain, plants
PfamPF002496.4E-7214261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MVHNRSIISH NIDSGCFPSP HLDAFPAGLR VLVVDDDPTW LRILEKMLKK CFYQVTTCCL  60
AIEALKKLRE KKDAYDIVIS DVNMPDMDGF KLLEHVGLEM DLPVIMMSVD GETSRVMKGV  120
QHGACDYLLK PIRMKELRNI WQHVLRKRIH EAREFETFEG IHLMRNGSNH IDDGNLFAVG  180
GEMNLMKKRK DLDNKHDDKE FGDQTSLKKA RVIWSVDLHQ KFVKAVNRIG FDKIGPKKIL  240
DLMNVPWLTR ENVASHLQKY RLYLSRLQKE NDQKYSTGGI KYFDLPSKDS GCVSFLDSLN  300
KQQNDGAIDN FRYSDGTLKL HMESTSHEVD LNGIVTRPTI DKIRASVSDI IDPKIRKCSQ  360
IGHNQPYESA ESEVNHTVFE YSTVSTQCSW NEVPKMLLKE EQNTQKHFQI DQSQSMNSDP  420
SGYTSDYISP VNSMALEVVT FPSQSKSLVA NDQSPDIVFT SNLSSKAPGY NLGCISDMEI  480
YQRNLLLDSH AALTPLDEDL HLLLLQGEYY NMNFGMQNIE MSEYSDPWII AEVPTNLYDS  540
ADYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-17205267163ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA37040
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446511.10.0two-component response regulator ARR11
TrEMBLA0A2K3NEG60.0A0A2K3NEG6_TRIPR; Two-component response regulator ARR11-like protein
STRINGGLYMA05G27670.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-119response regulator 11