PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA36841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 132aa    MW: 14485.1 Da    PI: 6.5024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA36841genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26055.41.8e-1712802796
                     DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                               +++fa+vhk+F a+nv+kll++++++++++a++++ yeA+ r++d vyG v++il+lqqq++ ++ e+++
  Tp57577_TGAC_v2_mRNA36841 12 AASFAAVHKVFDANNVSKLLSNVSTNHHHEAVATISYEAQTRLSDQVYGYVSTILALQQQVAAKA-EISM 80
                               789*********************************************************98654.5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.146185IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-181077IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MQEQHKSIEQ GAASFAAVHK VFDANNVSKL LSNVSTNHHH EAVATISYEA QTRLSDQVYG  60
YVSTILALQQ QVAAKAEISM IETELMKRGF TCENALQTTP QQQPQMLHQP NFNVAVQPVY  120
SNNSYGCTNT S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451538.13e-43LOB domain protein
SwissprotQ9SRV33e-29LBD20_ARATH; LOB domain-containing protein 20
TrEMBLA0A072U8583e-43A0A072U858_MEDTR; LOB domain protein
STRINGGLYMA10G11031.14e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03760.11e-30LOB domain-containing protein 20